SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20018
         (688 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z46812-6|CAA86848.2|  546|Caenorhabditis elegans Hypothetical pr...    47   1e-05
Z46812-5|CAA86847.2|  775|Caenorhabditis elegans Hypothetical pr...    47   1e-05
Z37093-8|CAA85469.2|  546|Caenorhabditis elegans Hypothetical pr...    47   1e-05
Z37093-7|CAA85468.2|  775|Caenorhabditis elegans Hypothetical pr...    47   1e-05
Z81130-4|CAB03414.2|  512|Caenorhabditis elegans Hypothetical pr...    42   5e-04
U28741-7|AAO38645.1|  721|Caenorhabditis elegans Synapse defecti...    36   0.036
U28741-6|AAO21428.1|  942|Caenorhabditis elegans Synapse defecti...    36   0.036
U28741-5|AAO38644.1|  987|Caenorhabditis elegans Synapse defecti...    36   0.036
AF546880-1|AAN38752.1|  942|Caenorhabditis elegans axon identity...    36   0.036
AC024755-8|AAF59636.2|  604|Caenorhabditis elegans Hypothetical ...    31   0.77 
Z81068-1|CAB02982.1|  232|Caenorhabditis elegans Hypothetical pr...    29   2.4  
Z66521-14|CAI70416.1|  245|Caenorhabditis elegans Hypothetical p...    29   2.4  
Z66521-13|CAA91403.1|  444|Caenorhabditis elegans Hypothetical p...    29   2.4  
U02289-1|AAA18934.1| 1439|Caenorhabditis elegans GTPase-activati...    29   4.1  
L16687-1|AAK71357.2| 1317|Caenorhabditis elegans Hypothetical pr...    29   4.1  
U80955-10|AAN65297.2|  475|Caenorhabditis elegans Hypothetical p...    27   9.5  
U80955-9|AAN65296.1|  863|Caenorhabditis elegans Hypothetical pr...    27   9.5  
U80955-8|AAN65295.1|  881|Caenorhabditis elegans Hypothetical pr...    27   9.5  

>Z46812-6|CAA86848.2|  546|Caenorhabditis elegans Hypothetical
           protein ZK669.1b protein.
          Length = 546

 Score = 47.2 bits (107), Expect = 1e-05
 Identities = 25/59 (42%), Positives = 36/59 (61%)
 Frame = +3

Query: 282 IFGVPLQQSVERSRCHDDTGLPLVVRDSIDYLQAHGLKSKDIYRTEPDKIKFQQLRKLF 458
           IFGVPL+  +E    H +  +PL++  SID LQ  GL++K IYRT   K K +++   F
Sbjct: 176 IFGVPLKGLLE----HQNRHIPLIIEKSIDQLQRRGLRAKGIYRTCGVKSKIEEICNAF 230


>Z46812-5|CAA86847.2|  775|Caenorhabditis elegans Hypothetical
           protein ZK669.1a protein.
          Length = 775

 Score = 47.2 bits (107), Expect = 1e-05
 Identities = 25/59 (42%), Positives = 36/59 (61%)
 Frame = +3

Query: 282 IFGVPLQQSVERSRCHDDTGLPLVVRDSIDYLQAHGLKSKDIYRTEPDKIKFQQLRKLF 458
           IFGVPL+  +E    H +  +PL++  SID LQ  GL++K IYRT   K K +++   F
Sbjct: 405 IFGVPLKGLLE----HQNRHIPLIIEKSIDQLQRRGLRAKGIYRTCGVKSKIEEICNAF 459


>Z37093-8|CAA85469.2|  546|Caenorhabditis elegans Hypothetical
           protein ZK669.1b protein.
          Length = 546

 Score = 47.2 bits (107), Expect = 1e-05
 Identities = 25/59 (42%), Positives = 36/59 (61%)
 Frame = +3

Query: 282 IFGVPLQQSVERSRCHDDTGLPLVVRDSIDYLQAHGLKSKDIYRTEPDKIKFQQLRKLF 458
           IFGVPL+  +E    H +  +PL++  SID LQ  GL++K IYRT   K K +++   F
Sbjct: 176 IFGVPLKGLLE----HQNRHIPLIIEKSIDQLQRRGLRAKGIYRTCGVKSKIEEICNAF 230


>Z37093-7|CAA85468.2|  775|Caenorhabditis elegans Hypothetical
           protein ZK669.1a protein.
          Length = 775

 Score = 47.2 bits (107), Expect = 1e-05
 Identities = 25/59 (42%), Positives = 36/59 (61%)
 Frame = +3

Query: 282 IFGVPLQQSVERSRCHDDTGLPLVVRDSIDYLQAHGLKSKDIYRTEPDKIKFQQLRKLF 458
           IFGVPL+  +E    H +  +PL++  SID LQ  GL++K IYRT   K K +++   F
Sbjct: 405 IFGVPLKGLLE----HQNRHIPLIIEKSIDQLQRRGLRAKGIYRTCGVKSKIEEICNAF 459


>Z81130-4|CAB03414.2|  512|Caenorhabditis elegans Hypothetical
           protein T23G11.5 protein.
          Length = 512

 Score = 41.5 bits (93), Expect = 5e-04
 Identities = 19/57 (33%), Positives = 32/57 (56%)
 Frame = +3

Query: 282 IFGVPLQQSVERSRCHDDTGLPLVVRDSIDYLQAHGLKSKDIYRTEPDKIKFQQLRK 452
           + G+PL +SV      D   LP   R +ID+++ +GL ++ IYR  P K +  +L +
Sbjct: 52  VLGLPLTESVSADPSLDGIPLPSFFRYAIDFVEENGLCTEGIYRLSPPKSRLDELER 108


>U28741-7|AAO38645.1|  721|Caenorhabditis elegans Synapse defective
           protein 1, isoformc protein.
          Length = 721

 Score = 35.5 bits (78), Expect = 0.036
 Identities = 13/42 (30%), Positives = 27/42 (64%)
 Frame = +2

Query: 512 MLKAFISELPESILTQELHGQFEQATAIAEPQREATMTNLII 637
           ++K F+ ELPE +++ ++HG   +A ++A P    T  +L++
Sbjct: 563 LIKDFLRELPEPLISPQIHGMLLEAASVALPNDVQTNRHLVL 604


>U28741-6|AAO21428.1|  942|Caenorhabditis elegans Synapse defective
           protein 1, isoformb protein.
          Length = 942

 Score = 35.5 bits (78), Expect = 0.036
 Identities = 13/42 (30%), Positives = 27/42 (64%)
 Frame = +2

Query: 512 MLKAFISELPESILTQELHGQFEQATAIAEPQREATMTNLII 637
           ++K F+ ELPE +++ ++HG   +A ++A P    T  +L++
Sbjct: 761 LIKDFLRELPEPLISPQIHGMLLEAASVALPNDVQTNRHLVL 802


>U28741-5|AAO38644.1|  987|Caenorhabditis elegans Synapse defective
           protein 1, isoforma protein.
          Length = 987

 Score = 35.5 bits (78), Expect = 0.036
 Identities = 13/42 (30%), Positives = 27/42 (64%)
 Frame = +2

Query: 512 MLKAFISELPESILTQELHGQFEQATAIAEPQREATMTNLII 637
           ++K F+ ELPE +++ ++HG   +A ++A P    T  +L++
Sbjct: 829 LIKDFLRELPEPLISPQIHGMLLEAASVALPNDVQTNRHLVL 870


>AF546880-1|AAN38752.1|  942|Caenorhabditis elegans axon identity
           specification proteinSYD-1 protein.
          Length = 942

 Score = 35.5 bits (78), Expect = 0.036
 Identities = 13/42 (30%), Positives = 27/42 (64%)
 Frame = +2

Query: 512 MLKAFISELPESILTQELHGQFEQATAIAEPQREATMTNLII 637
           ++K F+ ELPE +++ ++HG   +A ++A P    T  +L++
Sbjct: 761 LIKDFLRELPEPLISPQIHGMLLEAASVALPNDVQTNRHLVL 802


>AC024755-8|AAF59636.2|  604|Caenorhabditis elegans Hypothetical
           protein Y34B4A.8 protein.
          Length = 604

 Score = 31.1 bits (67), Expect = 0.77
 Identities = 17/68 (25%), Positives = 35/68 (51%), Gaps = 2/68 (2%)
 Frame = +3

Query: 252 RIFTLGVALPIFGVPLQQ--SVERSRCHDDTGLPLVVRDSIDYLQAHGLKSKDIYRTEPD 425
           R+    +  P+FGVPL +  S+++ R         V+    D+L+ +G+  + I+R   +
Sbjct: 228 RMIATALPRPVFGVPLDEHLSIQKERISG------VLTKCCDFLRQNGMNERGIFRVSGN 281

Query: 426 KIKFQQLR 449
             K +++R
Sbjct: 282 ASKIKRIR 289


>Z81068-1|CAB02982.1|  232|Caenorhabditis elegans Hypothetical
           protein F25H5.2 protein.
          Length = 232

 Score = 29.5 bits (63), Expect = 2.4
 Identities = 15/43 (34%), Positives = 23/43 (53%), Gaps = 2/43 (4%)
 Frame = +1

Query: 538 PGIDTNTRAARSVRTSHRYS--RTSAGSDDDEPHHKLPNCNHI 660
           PG DTN     + +T +R+S  R  +GSD + P H   N  ++
Sbjct: 85  PGTDTNATLCCNPQTPYRHSLGRIVSGSDKNSPGHVSGNFGYV 127


>Z66521-14|CAI70416.1|  245|Caenorhabditis elegans Hypothetical
           protein W02B12.8b protein.
          Length = 245

 Score = 29.5 bits (63), Expect = 2.4
 Identities = 15/43 (34%), Positives = 24/43 (55%)
 Frame = +3

Query: 285 FGVPLQQSVERSRCHDDTGLPLVVRDSIDYLQAHGLKSKDIYR 413
           FGVPL+  +     H    +P +V   I+YL+AH L  + ++R
Sbjct: 48  FGVPLEFILS----HCGGNIPPIVDQLIEYLEAHALTMEGVFR 86


>Z66521-13|CAA91403.1|  444|Caenorhabditis elegans Hypothetical
           protein W02B12.8a protein.
          Length = 444

 Score = 29.5 bits (63), Expect = 2.4
 Identities = 15/43 (34%), Positives = 24/43 (55%)
 Frame = +3

Query: 285 FGVPLQQSVERSRCHDDTGLPLVVRDSIDYLQAHGLKSKDIYR 413
           FGVPL+  +     H    +P +V   I+YL+AH L  + ++R
Sbjct: 247 FGVPLEFILS----HCGGNIPPIVDQLIEYLEAHALTMEGVFR 285


>U02289-1|AAA18934.1| 1439|Caenorhabditis elegans GTPase-activating
           protein protein.
          Length = 1439

 Score = 28.7 bits (61), Expect = 4.1
 Identities = 16/68 (23%), Positives = 33/68 (48%)
 Frame = +3

Query: 267 GVALPIFGVPLQQSVERSRCHDDTGLPLVVRDSIDYLQAHGLKSKDIYRTEPDKIKFQQL 446
           G   P+ GV +      S C D   +P++V+  +  ++ +G+ +  IYR   +      L
Sbjct: 774 GAPQPVLGVRIADCPTGS-CEDH--VPMIVQACVCVIETYGMDTVGIYRIPGNTAAVNAL 830

Query: 447 RKLFTDRG 470
           ++  ++RG
Sbjct: 831 KESLSNRG 838


>L16687-1|AAK71357.2| 1317|Caenorhabditis elegans Hypothetical
           protein C04D8.1 protein.
          Length = 1317

 Score = 28.7 bits (61), Expect = 4.1
 Identities = 16/68 (23%), Positives = 33/68 (48%)
 Frame = +3

Query: 267 GVALPIFGVPLQQSVERSRCHDDTGLPLVVRDSIDYLQAHGLKSKDIYRTEPDKIKFQQL 446
           G   P+ GV +      S C D   +P++V+  +  ++ +G+ +  IYR   +      L
Sbjct: 652 GAPQPVLGVRIADCPTGS-CEDH--VPMIVQACVCVIETYGMDTVGIYRIPGNTAAVNAL 708

Query: 447 RKLFTDRG 470
           ++  ++RG
Sbjct: 709 KESLSNRG 716


>U80955-10|AAN65297.2|  475|Caenorhabditis elegans Hypothetical
           protein T04C9.1c protein.
          Length = 475

 Score = 27.5 bits (58), Expect = 9.5
 Identities = 11/29 (37%), Positives = 17/29 (58%)
 Frame = +2

Query: 515 LKAFISELPESILTQELHGQFEQATAIAE 601
           +K F+  LPE ++T ELH  F  A  + +
Sbjct: 135 VKTFLRNLPEPLMTFELHNVFINAAKMGD 163


>U80955-9|AAN65296.1|  863|Caenorhabditis elegans Hypothetical
           protein T04C9.1b protein.
          Length = 863

 Score = 27.5 bits (58), Expect = 9.5
 Identities = 11/29 (37%), Positives = 17/29 (58%)
 Frame = +2

Query: 515 LKAFISELPESILTQELHGQFEQATAIAE 601
           +K F+  LPE ++T ELH  F  A  + +
Sbjct: 475 VKTFLRNLPEPLMTFELHNVFINAAKMGD 503


>U80955-8|AAN65295.1|  881|Caenorhabditis elegans Hypothetical
           protein T04C9.1a protein.
          Length = 881

 Score = 27.5 bits (58), Expect = 9.5
 Identities = 11/29 (37%), Positives = 17/29 (58%)
 Frame = +2

Query: 515 LKAFISELPESILTQELHGQFEQATAIAE 601
           +K F+  LPE ++T ELH  F  A  + +
Sbjct: 475 VKTFLRNLPEPLMTFELHNVFINAAKMGD 503


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 12,018,240
Number of Sequences: 27780
Number of extensions: 242514
Number of successful extensions: 718
Number of sequences better than 10.0: 18
Number of HSP's better than 10.0 without gapping: 695
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 715
length of database: 12,740,198
effective HSP length: 79
effective length of database: 10,545,578
effective search space used: 1571291122
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -