SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20015
         (627 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z72502-5|CAA96590.1|  193|Caenorhabditis elegans Hypothetical pr...    73   2e-13
U51997-2|AAG24069.1|  332|Caenorhabditis elegans Serpentine rece...    29   2.1  
AF039053-12|AAC25872.3|  289|Caenorhabditis elegans Serpentine r...    29   2.7  
AF016446-5|AAC24163.1|  329|Caenorhabditis elegans Serpentine re...    27   8.3  

>Z72502-5|CAA96590.1|  193|Caenorhabditis elegans Hypothetical
           protein C08B6.8 protein.
          Length = 193

 Score = 72.9 bits (171), Expect = 2e-13
 Identities = 31/55 (56%), Positives = 43/55 (78%)
 Frame = +3

Query: 345 IAQRIVWMDLEMTGLDIENDHIMEIACLVTDAQLNVVATGPDIVINLPEVTLNKI 509
           I QRI+W+D EMTGLD+E   + EIA +VTD++LN +ATGPDIVI+ P+  L+ +
Sbjct: 11  IEQRIIWIDCEMTGLDVEKQTLCEIALIVTDSELNTIATGPDIVIHQPKEVLDNM 65


>U51997-2|AAG24069.1|  332|Caenorhabditis elegans Serpentine
           receptor, class h protein19 protein.
          Length = 332

 Score = 29.5 bits (63), Expect = 2.1
 Identities = 19/88 (21%), Positives = 37/88 (42%), Gaps = 7/88 (7%)
 Frame = -3

Query: 550 CQPCLAVLDLTPVIILFKVTSGRFITI----SGPVATTFSCASVTRHAISIMWSFS---M 392
           C     ++  T  +  F + +  FIT+    S P+   +   S+ R    + W      +
Sbjct: 180 CSSSFLLIPFTDYVSTFVLGAWIFITVILTFSLPITALYINISIPRSTSHVNWKIQKQLL 239

Query: 391 SSPVISRSIHTIL*AMSTLVFFFVIIFG 308
              VI  ++H IL  +   +F + ++FG
Sbjct: 240 KRLVIQFAVHEILMGIPHCMFIYAVLFG 267


>AF039053-12|AAC25872.3|  289|Caenorhabditis elegans Serpentine
           receptor, class bc (class b-like) protein 18 protein.
          Length = 289

 Score = 29.1 bits (62), Expect = 2.7
 Identities = 28/116 (24%), Positives = 51/116 (43%)
 Frame = -3

Query: 463 PVATTFSCASVTRHAISIMWSFSMSSPVISRSIHTIL*AMSTLVFFFVIIFGDMDKLRVK 284
           P++   +C S+   AISI  S ++ SP+   +   +    S  +    + +G  + L   
Sbjct: 90  PISNISTCRSIVSLAISIERSVAVYSPIFYHNYRKL--CPSIFILLIAVSYGLAENL--- 144

Query: 283 NVIAFVIT*IYHVVCNCFNVK*TLHVERNCMSLHKKNEINSCTTLHYIHTISEIYL 116
                    + H VCN      T+++  NC +L     +NSC   ++  TIS++ L
Sbjct: 145 ---------VLHAVCNY-----TIYLSENCAAL--GCAVNSCFNKYW--TISKLIL 182


>AF016446-5|AAC24163.1|  329|Caenorhabditis elegans Serpentine
           receptor, class h protein22 protein.
          Length = 329

 Score = 27.5 bits (58), Expect = 8.3
 Identities = 20/74 (27%), Positives = 34/74 (45%), Gaps = 3/74 (4%)
 Frame = -3

Query: 520 TPVIILFKVTSGRFITISGPVATTFSCASVTRHAISIMWSFS---MSSPVISRSIHTIL* 350
           T +IIL+ +     + +S P    F   S+++ A    W      + S VI  SIH+I+ 
Sbjct: 195 TTIIILW-IVECIVLFLSIPGTAIFINLSISKSASESTWKIQKNLLKSLVIQASIHSIMM 253

Query: 349 AMSTLVFFFVIIFG 308
            +   +F +   FG
Sbjct: 254 GVPNGMFNYAFFFG 267


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 13,083,800
Number of Sequences: 27780
Number of extensions: 277810
Number of successful extensions: 704
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 681
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 704
length of database: 12,740,198
effective HSP length: 78
effective length of database: 10,573,358
effective search space used: 1374536540
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -