SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20013
         (724 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z92835-1|CAB07395.2|  532|Caenorhabditis elegans Hypothetical pr...   162   2e-40
Z81098-7|CAI79193.2|  592|Caenorhabditis elegans Hypothetical pr...   107   8e-24
Z81098-6|CAB03180.3|  610|Caenorhabditis elegans Hypothetical pr...   107   8e-24
U51994-9|AAO21383.1|  267|Caenorhabditis elegans Elongation fact...    91   6e-19
U51994-6|AAA96068.1|  463|Caenorhabditis elegans Elongation fact...    91   6e-19
U40935-2|AAA81688.1|  463|Caenorhabditis elegans Elongation fact...    91   6e-19
U51994-7|AAO21384.1|  429|Caenorhabditis elegans Elongation fact...    73   2e-13
U51994-8|AAO21382.1|   77|Caenorhabditis elegans Elongation fact...    66   2e-11
D38472-1|BAA07492.1|  495|Caenorhabditis elegans elongation fact...    60   2e-09
D38471-1|BAA07491.1|  496|Caenorhabditis elegans elongation fact...    60   2e-09
AC024859-25|AAK29979.1|  496|Caenorhabditis elegans Tu elongatio...    60   2e-09
U80437-9|AAN84843.1|  439|Caenorhabditis elegans Tu elongation f...    59   3e-09
AB010028-1|BAA31345.1|  439|Caenorhabditis elegans mitochondrial...    59   3e-09
Z70780-15|CAA94822.2|  702|Caenorhabditis elegans Hypothetical p...    38   0.005
L13200-4|AAA28191.2|  645|Caenorhabditis elegans Hypothetical pr...    36   0.039
Z83235-9|CAI79209.1|  705|Caenorhabditis elegans Hypothetical pr...    33   0.16 
Z83235-8|CAB05774.2|  894|Caenorhabditis elegans Hypothetical pr...    33   0.16 
Z81519-1|CAB04216.1|  750|Caenorhabditis elegans Hypothetical pr...    33   0.16 
DQ867020-1|ABI49097.1| 1074|Caenorhabditis elegans eukaryotic tr...    33   0.27 
AC025716-9|AAK39619.1|  469|Caenorhabditis elegans Hypothetical ...    33   0.27 
Z68004-7|CAA91988.2|  237|Caenorhabditis elegans Hypothetical pr...    31   1.1  
Z99942-7|CAB17070.2|  462|Caenorhabditis elegans Hypothetical pr...    30   1.9  
U55367-2|AAA97988.2|  356|Caenorhabditis elegans G protein, alph...    29   2.5  
AY008132-1|AAG32085.1|  356|Caenorhabditis elegans heterotrimeri...    29   2.5  
AF036692-9|AAB88330.1|  389|Caenorhabditis elegans Hypothetical ...    29   2.5  
AC006714-2|AAK29716.2|  689|Caenorhabditis elegans Hypothetical ...    29   3.4  
Z93394-1|CAB07703.1|  369|Caenorhabditis elegans Hypothetical pr...    28   5.9  
U50193-2|AAA91248.1|  974|Caenorhabditis elegans Elongation fact...    28   5.9  
M86958-1|AAA21824.1|  849|Caenorhabditis elegans eft-1 protein.        28   5.9  
AY125085-1|AAM94369.1| 1113|Caenorhabditis elegans regulatory cy...    28   5.9  
AF024497-5|AAO21477.1|  871|Caenorhabditis elegans Defective in ...    28   5.9  
AF024497-4|AAO21479.1|  807|Caenorhabditis elegans Defective in ...    28   5.9  
AF024497-3|AAO21478.1| 1036|Caenorhabditis elegans Defective in ...    28   5.9  
AF024497-2|AAB70342.2| 1113|Caenorhabditis elegans Defective in ...    28   5.9  
AF003386-9|AAB54259.1| 1621|Caenorhabditis elegans Hypothetical ...    28   5.9  
Z81068-5|CAB02985.1|  852|Caenorhabditis elegans Hypothetical pr...    28   7.8  
M86959-1|AAD03339.1|  852|Caenorhabditis elegans elongation fact...    28   7.8  
AC006695-8|AAF39976.1|  351|Caenorhabditis elegans Hypothetical ...    28   7.8  

>Z92835-1|CAB07395.2|  532|Caenorhabditis elegans Hypothetical
           protein H19N07.1 protein.
          Length = 532

 Score =  162 bits (394), Expect = 2e-40
 Identities = 73/82 (89%), Positives = 78/82 (95%)
 Frame = +3

Query: 264 WYLSWALDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGAAQADLAV 443
           WYLSW +DTN EER+KGKTVEVGRAYFETEK+HFTILDAPGHKSFVPNMI GA QADLAV
Sbjct: 156 WYLSWCMDTNDEEREKGKTVEVGRAYFETEKRHFTILDAPGHKSFVPNMIVGANQADLAV 215

Query: 444 LVISARKGEFETGFDRGGQTRD 509
           LVISAR+GEFETGFDRGGQTR+
Sbjct: 216 LVISARRGEFETGFDRGGQTRE 237



 Score = 95.9 bits (228), Expect = 3e-20
 Identities = 49/100 (49%), Positives = 64/100 (64%), Gaps = 1/100 (1%)
 Frame = +1

Query: 22  TQVGNTNPNEDGELTKKIPKKKPPRVE-DTRSKKEHVNVVFIGHVDAGKSTIGGQIMSLT 198
           T+     P  + +L   + KK    V  D  + KEH+N+VF+GHVDAGKSTIGGQ+M LT
Sbjct: 74  TEAPKKEPTPEEDLVAPLAKKFQRTVYVDDGTHKEHINMVFVGHVDAGKSTIGGQLMFLT 133

Query: 199 GMVDKRTLEKYEREAREKSENHGTYHGHWTQIKKNETKAK 318
           GMVDKRTLEKYEREA+EK     +++  W     +E + K
Sbjct: 134 GMVDKRTLEKYEREAKEKGRE--SWYLSWCMDTNDEEREK 171



 Score = 70.5 bits (165), Expect = 1e-12
 Identities = 29/44 (65%), Positives = 36/44 (81%)
 Frame = +2

Query: 509 HAMLAKTAGVKHLVALVNKMDDPTVNWDEKRYNECREKILPYLK 640
           H+ML KTAGVKHLV LVNKMDDPTV W+E+R+ E   K+ P+L+
Sbjct: 238 HSMLVKTAGVKHLVILVNKMDDPTVKWEEERFKEIEGKLTPFLR 281


>Z81098-7|CAI79193.2|  592|Caenorhabditis elegans Hypothetical
           protein K07A12.4b protein.
          Length = 592

 Score =  107 bits (257), Expect = 8e-24
 Identities = 45/87 (51%), Positives = 63/87 (72%)
 Frame = +3

Query: 273 SWALDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGAAQADLAVLVI 452
           +W LD  +EER++G T+++GR  FET  +   +LDAPGHK F+ NMI G +QAD A+LV+
Sbjct: 220 AWVLDETEEERERGVTMDIGRTSFETSHRRIVLLDAPGHKDFISNMITGTSQADAAILVV 279

Query: 453 SARKGEFETGFDRGGQTRDMRC*LKQL 533
           +A  GEFETGF+ GGQT++    L+ L
Sbjct: 280 NATTGEFETGFENGGQTKEHALLLRSL 306



 Score = 54.0 bits (124), Expect = 1e-07
 Identities = 30/92 (32%), Positives = 49/92 (53%), Gaps = 1/92 (1%)
 Frame = +1

Query: 1   RHEEELDTQVGNTNPNEDGELTKKIPKKKP-PRVEDTRSKKEHVNVVFIGHVDAGKSTIG 177
           R   E+D      N  ++      + +K P PRV D    K+ +N++ +GHVDAGKST+ 
Sbjct: 132 RPSSEVDLTSFRRNQLQNIAKAPSVARKTPKPRVAD----KDLINLIVVGHVDAGKSTLM 187

Query: 178 GQIMSLTGMVDKRTLEKYEREAREKSENHGTY 273
           G ++    +VD RT++K++ EA    +    Y
Sbjct: 188 GHLLHDLEVVDSRTIDKFKHEAARNGKASFAY 219



 Score = 39.1 bits (87), Expect = 0.003
 Identities = 20/63 (31%), Positives = 34/63 (53%), Gaps = 1/63 (1%)
 Frame = +2

Query: 509 HAMLAKTAGVKHLVALVNKMDDPTVNWDEKRYNECREKILPYLKNWVSIQR-KTYPSFLF 685
           HA+L ++ GV  L+  VNK+D  TV+W + R++E +  +  +L       + K  P   F
Sbjct: 299 HALLLRSLGVTQLIVAVNKLD--TVDWSQDRFDEIKNNLSVFLTRQAGFSKPKFVPVSGF 356

Query: 686 PGK 694
            G+
Sbjct: 357 TGE 359


>Z81098-6|CAB03180.3|  610|Caenorhabditis elegans Hypothetical
           protein K07A12.4a protein.
          Length = 610

 Score =  107 bits (257), Expect = 8e-24
 Identities = 45/87 (51%), Positives = 63/87 (72%)
 Frame = +3

Query: 273 SWALDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGAAQADLAVLVI 452
           +W LD  +EER++G T+++GR  FET  +   +LDAPGHK F+ NMI G +QAD A+LV+
Sbjct: 238 AWVLDETEEERERGVTMDIGRTSFETSHRRIVLLDAPGHKDFISNMITGTSQADAAILVV 297

Query: 453 SARKGEFETGFDRGGQTRDMRC*LKQL 533
           +A  GEFETGF+ GGQT++    L+ L
Sbjct: 298 NATTGEFETGFENGGQTKEHALLLRSL 324



 Score = 54.0 bits (124), Expect = 1e-07
 Identities = 30/92 (32%), Positives = 49/92 (53%), Gaps = 1/92 (1%)
 Frame = +1

Query: 1   RHEEELDTQVGNTNPNEDGELTKKIPKKKP-PRVEDTRSKKEHVNVVFIGHVDAGKSTIG 177
           R   E+D      N  ++      + +K P PRV D    K+ +N++ +GHVDAGKST+ 
Sbjct: 150 RPSSEVDLTSFRRNQLQNIAKAPSVARKTPKPRVAD----KDLINLIVVGHVDAGKSTLM 205

Query: 178 GQIMSLTGMVDKRTLEKYEREAREKSENHGTY 273
           G ++    +VD RT++K++ EA    +    Y
Sbjct: 206 GHLLHDLEVVDSRTIDKFKHEAARNGKASFAY 237



 Score = 39.1 bits (87), Expect = 0.003
 Identities = 20/63 (31%), Positives = 34/63 (53%), Gaps = 1/63 (1%)
 Frame = +2

Query: 509 HAMLAKTAGVKHLVALVNKMDDPTVNWDEKRYNECREKILPYLKNWVSIQR-KTYPSFLF 685
           HA+L ++ GV  L+  VNK+D  TV+W + R++E +  +  +L       + K  P   F
Sbjct: 317 HALLLRSLGVTQLIVAVNKLD--TVDWSQDRFDEIKNNLSVFLTRQAGFSKPKFVPVSGF 374

Query: 686 PGK 694
            G+
Sbjct: 375 TGE 377


>U51994-9|AAO21383.1|  267|Caenorhabditis elegans Elongation factor
           protein 4, isoformc protein.
          Length = 267

 Score = 91.5 bits (217), Expect = 6e-19
 Identities = 39/79 (49%), Positives = 55/79 (69%)
 Frame = +3

Query: 273 SWALDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGAAQADLAVLVI 452
           +W LD  + ER++G T+++    FET K + TI+DAPGH+ F+ NMI G +QAD AVLV+
Sbjct: 57  AWVLDKLKAERERGITIDIALWKFETAKYYITIIDAPGHRDFIKNMITGTSQADCAVLVV 116

Query: 453 SARKGEFETGFDRGGQTRD 509
           +   GEFE G  + GQTR+
Sbjct: 117 ACGTGEFEAGISKNGQTRE 135



 Score = 61.7 bits (143), Expect = 5e-10
 Identities = 26/53 (49%), Positives = 38/53 (71%)
 Frame = +1

Query: 115 KKEHVNVVFIGHVDAGKSTIGGQIMSLTGMVDKRTLEKYEREAREKSENHGTY 273
           +K H+N+V IGHVD+GKST  G ++   G +DKRT+EK+E+EA+E  +    Y
Sbjct: 4   EKVHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKY 56


>U51994-6|AAA96068.1|  463|Caenorhabditis elegans Elongation factor
           protein 4, isoforma protein.
          Length = 463

 Score = 91.5 bits (217), Expect = 6e-19
 Identities = 39/79 (49%), Positives = 55/79 (69%)
 Frame = +3

Query: 273 SWALDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGAAQADLAVLVI 452
           +W LD  + ER++G T+++    FET K + TI+DAPGH+ F+ NMI G +QAD AVLV+
Sbjct: 57  AWVLDKLKAERERGITIDIALWKFETAKYYITIIDAPGHRDFIKNMITGTSQADCAVLVV 116

Query: 453 SARKGEFETGFDRGGQTRD 509
           +   GEFE G  + GQTR+
Sbjct: 117 ACGTGEFEAGISKNGQTRE 135



 Score = 61.7 bits (143), Expect = 5e-10
 Identities = 26/53 (49%), Positives = 38/53 (71%)
 Frame = +1

Query: 115 KKEHVNVVFIGHVDAGKSTIGGQIMSLTGMVDKRTLEKYEREAREKSENHGTY 273
           +K H+N+V IGHVD+GKST  G ++   G +DKRT+EK+E+EA+E  +    Y
Sbjct: 4   EKVHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKY 56



 Score = 39.9 bits (89), Expect = 0.002
 Identities = 17/44 (38%), Positives = 26/44 (59%)
 Frame = +2

Query: 509 HAMLAKTAGVKHLVALVNKMDDPTVNWDEKRYNECREKILPYLK 640
           HA+LA+T GVK L+   NKMD     + E R+ E   ++  ++K
Sbjct: 136 HALLAQTLGVKQLIVACNKMDSTEPPFSEARFTEITNEVSGFIK 179


>U40935-2|AAA81688.1|  463|Caenorhabditis elegans Elongation factor
           protein 3 protein.
          Length = 463

 Score = 91.5 bits (217), Expect = 6e-19
 Identities = 39/79 (49%), Positives = 55/79 (69%)
 Frame = +3

Query: 273 SWALDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGAAQADLAVLVI 452
           +W LD  + ER++G T+++    FET K + TI+DAPGH+ F+ NMI G +QAD AVLV+
Sbjct: 57  AWVLDKLKAERERGITIDIALWKFETAKYYITIIDAPGHRDFIKNMITGTSQADCAVLVV 116

Query: 453 SARKGEFETGFDRGGQTRD 509
           +   GEFE G  + GQTR+
Sbjct: 117 ACGTGEFEAGISKNGQTRE 135



 Score = 61.7 bits (143), Expect = 5e-10
 Identities = 26/53 (49%), Positives = 38/53 (71%)
 Frame = +1

Query: 115 KKEHVNVVFIGHVDAGKSTIGGQIMSLTGMVDKRTLEKYEREAREKSENHGTY 273
           +K H+N+V IGHVD+GKST  G ++   G +DKRT+EK+E+EA+E  +    Y
Sbjct: 4   EKVHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKY 56



 Score = 39.9 bits (89), Expect = 0.002
 Identities = 17/44 (38%), Positives = 26/44 (59%)
 Frame = +2

Query: 509 HAMLAKTAGVKHLVALVNKMDDPTVNWDEKRYNECREKILPYLK 640
           HA+LA+T GVK L+   NKMD     + E R+ E   ++  ++K
Sbjct: 136 HALLAQTLGVKQLIVACNKMDSTEPPFSEARFTEITNEVSGFIK 179


>U51994-7|AAO21384.1|  429|Caenorhabditis elegans Elongation factor
           protein 4, isoformd protein.
          Length = 429

 Score = 73.3 bits (172), Expect = 2e-13
 Identities = 31/64 (48%), Positives = 45/64 (70%)
 Frame = +3

Query: 273 SWALDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGAAQADLAVLVI 452
           +W LD  + ER++G T+++    FET K + TI+DAPGH+ F+ NMI G +QAD AVLV+
Sbjct: 57  AWVLDKLKAERERGITIDIALWKFETAKYYITIIDAPGHRDFIKNMITGTSQADCAVLVV 116

Query: 453 SARK 464
           +  K
Sbjct: 117 ACNK 120



 Score = 61.7 bits (143), Expect = 5e-10
 Identities = 26/53 (49%), Positives = 38/53 (71%)
 Frame = +1

Query: 115 KKEHVNVVFIGHVDAGKSTIGGQIMSLTGMVDKRTLEKYEREAREKSENHGTY 273
           +K H+N+V IGHVD+GKST  G ++   G +DKRT+EK+E+EA+E  +    Y
Sbjct: 4   EKVHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKY 56


>U51994-8|AAO21382.1|   77|Caenorhabditis elegans Elongation factor
           protein 4, isoformb protein.
          Length = 77

 Score = 66.1 bits (154), Expect = 2e-11
 Identities = 31/69 (44%), Positives = 46/69 (66%)
 Frame = +1

Query: 115 KKEHVNVVFIGHVDAGKSTIGGQIMSLTGMVDKRTLEKYEREAREKSENHGTYHGHWTQI 294
           +K H+N+V IGHVD+GKST  G ++   G +DKRT+EK+E+EA+E  +  G++   W   
Sbjct: 4   EKVHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGK--GSFKYAWVLD 61

Query: 295 KKNETKAKQ 321
           K   TK+ Q
Sbjct: 62  KLKVTKSAQ 70


>D38472-1|BAA07492.1|  495|Caenorhabditis elegans elongation factor
           Tu homologueprecursor protein.
          Length = 495

 Score = 59.7 bits (138), Expect = 2e-09
 Identities = 25/62 (40%), Positives = 39/62 (62%)
 Frame = +3

Query: 282 LDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGAAQADLAVLVISAR 461
           +D   EE+ +G T+      +ET K+H+  +D PGH  ++ NMI GAAQ + A+LV++A 
Sbjct: 87  IDNAPEEKARGITINAFHLEYETAKRHYAHIDCPGHADYIKNMITGAAQMEGAILVVAAT 146

Query: 462 KG 467
            G
Sbjct: 147 DG 148



 Score = 33.1 bits (72), Expect = 0.21
 Identities = 16/39 (41%), Positives = 20/39 (51%)
 Frame = +1

Query: 118 KEHVNVVFIGHVDAGKSTIGGQIMSLTGMVDKRTLEKYE 234
           K H+NV  IGHVD GK+T+   I  +          KYE
Sbjct: 47  KPHLNVGTIGHVDHGKTTLTSAITKILATSKGAKYRKYE 85


>D38471-1|BAA07491.1|  496|Caenorhabditis elegans elongation factor
           Tu homologueprecursor protein.
          Length = 496

 Score = 59.7 bits (138), Expect = 2e-09
 Identities = 25/62 (40%), Positives = 39/62 (62%)
 Frame = +3

Query: 282 LDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGAAQADLAVLVISAR 461
           +D   EE+ +G T+      +ET K+H+  +D PGH  ++ NMI GAAQ + A+LV++A 
Sbjct: 88  IDNAPEEKARGITINAFHLEYETAKRHYAHIDCPGHADYIKNMITGAAQMEGAILVVAAT 147

Query: 462 KG 467
            G
Sbjct: 148 DG 149



 Score = 33.1 bits (72), Expect = 0.21
 Identities = 16/39 (41%), Positives = 20/39 (51%)
 Frame = +1

Query: 118 KEHVNVVFIGHVDAGKSTIGGQIMSLTGMVDKRTLEKYE 234
           K H+NV  IGHVD GK+T+   I  +          KYE
Sbjct: 48  KPHLNVGTIGHVDHGKTTLTSAITKILATSKGAKYRKYE 86


>AC024859-25|AAK29979.1|  496|Caenorhabditis elegans Tu elongation
           factor (ef-tu), mitochondrialprotein 1 protein.
          Length = 496

 Score = 59.7 bits (138), Expect = 2e-09
 Identities = 25/62 (40%), Positives = 39/62 (62%)
 Frame = +3

Query: 282 LDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGAAQADLAVLVISAR 461
           +D   EE+ +G T+      +ET K+H+  +D PGH  ++ NMI GAAQ + A+LV++A 
Sbjct: 88  IDNAPEEKARGITINAFHLEYETAKRHYAHIDCPGHADYIKNMITGAAQMEGAILVVAAT 147

Query: 462 KG 467
            G
Sbjct: 148 DG 149



 Score = 33.1 bits (72), Expect = 0.21
 Identities = 16/39 (41%), Positives = 20/39 (51%)
 Frame = +1

Query: 118 KEHVNVVFIGHVDAGKSTIGGQIMSLTGMVDKRTLEKYE 234
           K H+NV  IGHVD GK+T+   I  +          KYE
Sbjct: 48  KPHLNVGTIGHVDHGKTTLTSAITKILATSKGAKYRKYE 86


>U80437-9|AAN84843.1|  439|Caenorhabditis elegans Tu elongation
           factor (ef-tu), mitochondrialprotein 2 protein.
          Length = 439

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 26/65 (40%), Positives = 40/65 (61%)
 Frame = +3

Query: 282 LDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGAAQADLAVLVISAR 461
           +D  +EE+ +G T+ V    +E+  + ++  D PGH  F+ NMI G +Q D+AVLVI+A 
Sbjct: 83  IDKGKEEKKRGITINVAHIGYESPLRRYSHTDCPGHSDFIKNMICGTSQMDVAVLVIAAT 142

Query: 462 KGEFE 476
            G  E
Sbjct: 143 DGVME 147


>AB010028-1|BAA31345.1|  439|Caenorhabditis elegans mitochondrial
           elongation factorTu homologue protein.
          Length = 439

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 26/65 (40%), Positives = 40/65 (61%)
 Frame = +3

Query: 282 LDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGAAQADLAVLVISAR 461
           +D  +EE+ +G T+ V    +E+  + ++  D PGH  F+ NMI G +Q D+AVLVI+A 
Sbjct: 83  IDKGKEEKKRGITINVAHIGYESPLRRYSHTDCPGHSDFIKNMICGTSQMDVAVLVIAAT 142

Query: 462 KGEFE 476
            G  E
Sbjct: 143 DGVME 147


>Z70780-15|CAA94822.2|  702|Caenorhabditis elegans Hypothetical
           protein F46B6.6a protein.
          Length = 702

 Score = 38.3 bits (85), Expect = 0.005
 Identities = 21/53 (39%), Positives = 28/53 (52%), Gaps = 1/53 (1%)
 Frame = +3

Query: 312 GKTVEVGRAYFE-TEKKHFTILDAPGHKSFVPNMIGGAAQADLAVLVISARKG 467
           G T  +G    E T+ +  T LD PGH +F      GA  AD+ VLV++A  G
Sbjct: 188 GITQHIGAFSVELTKGRRVTFLDTPGHAAFASMRARGAKGADIVVLVVAADDG 240


>L13200-4|AAA28191.2|  645|Caenorhabditis elegans Hypothetical
           protein ZK1236.1 protein.
          Length = 645

 Score = 35.5 bits (78), Expect = 0.039
 Identities = 19/62 (30%), Positives = 30/62 (48%)
 Frame = +3

Query: 282 LDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGAAQADLAVLVISAR 461
           LD  Q ER++G TV+   A          ++D PGH  F   +    A  D  +L+++A 
Sbjct: 77  LDKLQVERERGITVKAQTAALRHRGYLLNLIDTPGHVDFSAEVSRSLAVCDGILLLVAAN 136

Query: 462 KG 467
           +G
Sbjct: 137 QG 138



 Score = 29.1 bits (62), Expect = 3.4
 Identities = 16/44 (36%), Positives = 26/44 (59%), Gaps = 3/44 (6%)
 Frame = +1

Query: 130 NVVFIGHVDAGKSTIGGQIMSLTGMV---DKRTLEKYEREAREK 252
           N   + HVD GKST+  +++ + G V    K+ L+K + E RE+
Sbjct: 44  NFGIVAHVDHGKSTLADRLLEMCGAVPPGQKQMLDKLQVE-RER 86


>Z83235-9|CAI79209.1|  705|Caenorhabditis elegans Hypothetical
           protein K10C3.5b protein.
          Length = 705

 Score = 33.5 bits (73), Expect = 0.16
 Identities = 15/62 (24%), Positives = 32/62 (51%)
 Frame = +3

Query: 282 LDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGAAQADLAVLVISAR 461
           +D+ ++E+ +G T++        E     ++D+PGH  F   +      +D+A+L+I   
Sbjct: 58  MDSREDEQTRGITMKSSGISLLCEPLLINLIDSPGHVDFSGEVTSALILSDIALLLIDVI 117

Query: 462 KG 467
           +G
Sbjct: 118 EG 119



 Score = 31.5 bits (68), Expect = 0.63
 Identities = 15/51 (29%), Positives = 26/51 (50%), Gaps = 2/51 (3%)
 Frame = +1

Query: 121 EHV-NVVFIGHVDAGKSTIGGQIMSLTGMVDKRTLEKYE-REAREKSENHG 267
           EH+ NV  + HVD GK++    ++S   ++  R   K    ++RE  +  G
Sbjct: 18  EHIRNVCLVAHVDHGKTSFADSLVSANAVISSRMAGKLRYMDSREDEQTRG 68


>Z83235-8|CAB05774.2|  894|Caenorhabditis elegans Hypothetical
           protein K10C3.5a protein.
          Length = 894

 Score = 33.5 bits (73), Expect = 0.16
 Identities = 15/62 (24%), Positives = 32/62 (51%)
 Frame = +3

Query: 282 LDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGAAQADLAVLVISAR 461
           +D+ ++E+ +G T++        E     ++D+PGH  F   +      +D+A+L+I   
Sbjct: 58  MDSREDEQTRGITMKSSGISLLCEPLLINLIDSPGHVDFSGEVTSALILSDIALLLIDVI 117

Query: 462 KG 467
           +G
Sbjct: 118 EG 119



 Score = 31.5 bits (68), Expect = 0.63
 Identities = 15/51 (29%), Positives = 26/51 (50%), Gaps = 2/51 (3%)
 Frame = +1

Query: 121 EHV-NVVFIGHVDAGKSTIGGQIMSLTGMVDKRTLEKYE-REAREKSENHG 267
           EH+ NV  + HVD GK++    ++S   ++  R   K    ++RE  +  G
Sbjct: 18  EHIRNVCLVAHVDHGKTSFADSLVSANAVISSRMAGKLRYMDSREDEQTRG 68


>Z81519-1|CAB04216.1|  750|Caenorhabditis elegans Hypothetical
           protein F29C12.4 protein.
          Length = 750

 Score = 33.5 bits (73), Expect = 0.16
 Identities = 17/57 (29%), Positives = 26/57 (45%)
 Frame = +3

Query: 282 LDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGAAQADLAVLVI 452
           +D    ER +G T++    Y +    +  I+D PGH  F   +       D AVLV+
Sbjct: 87  MDFMDLERQRGITIQSAATYVDWHGTNINIIDTPGHVDFTVEVERALRVLDGAVLVL 143


>DQ867020-1|ABI49097.1| 1074|Caenorhabditis elegans eukaryotic
           translation initiationfactor eIF5B protein.
          Length = 1074

 Score = 32.7 bits (71), Expect = 0.27
 Identities = 14/35 (40%), Positives = 20/35 (57%)
 Frame = +3

Query: 363 FTILDAPGHKSFVPNMIGGAAQADLAVLVISARKG 467
           F I+D PGH+SF      G++  D A+LV+    G
Sbjct: 551 FLIIDTPGHESFSNLRTRGSSLCDFAILVVDIMHG 585


>AC025716-9|AAK39619.1|  469|Caenorhabditis elegans Hypothetical
           protein Y39G10AR.8 protein.
          Length = 469

 Score = 32.7 bits (71), Expect = 0.27
 Identities = 12/36 (33%), Positives = 21/36 (58%)
 Frame = +3

Query: 357 KHFTILDAPGHKSFVPNMIGGAAQADLAVLVISARK 464
           +H + +D PGH   +  M+ GAA  D A L+++  +
Sbjct: 127 RHVSFVDCPGHDILMATMLNGAAVMDAAFLLVAGNE 162



 Score = 30.7 bits (66), Expect = 1.1
 Identities = 16/46 (34%), Positives = 25/46 (54%)
 Frame = +1

Query: 91  PRVEDTRSKKEHVNVVFIGHVDAGKSTIGGQIMSLTGMVDKRTLEK 228
           P  E+  S++  +N+  IGHV  GKST+      +  +  KR LE+
Sbjct: 29  PLTEEVISRQATINIGTIGHVAHGKSTLVKAFSGVHTVKFKRELER 74


>Z68004-7|CAA91988.2|  237|Caenorhabditis elegans Hypothetical
           protein F47B10.8 protein.
          Length = 237

 Score = 30.7 bits (66), Expect = 1.1
 Identities = 10/22 (45%), Positives = 17/22 (77%)
 Frame = -1

Query: 604 ISFLIPVNCWIIHLVYKCYQMF 539
           +SF+I +NC  +H+VY+ +Q F
Sbjct: 199 MSFVIVINCIFLHVVYRTFQFF 220


>Z99942-7|CAB17070.2|  462|Caenorhabditis elegans Hypothetical
           protein H13N06.5 protein.
          Length = 462

 Score = 29.9 bits (64), Expect = 1.9
 Identities = 18/50 (36%), Positives = 28/50 (56%)
 Frame = +1

Query: 169 TIGGQIMSLTGMVDKRTLEKYEREAREKSENHGTYHGHWTQIKKNETKAK 318
           ++GG ++   G++   T+EK  R  R + + HG  HGH    +K ETK K
Sbjct: 245 SVGGWVLG--GIIAFLTVEKLVRILRGE-DGHGHSHGHSHGGEKKETKEK 291


>U55367-2|AAA97988.2|  356|Caenorhabditis elegans G protein, alpha
           subunit protein 10 protein.
          Length = 356

 Score = 29.5 bits (63), Expect = 2.5
 Identities = 18/57 (31%), Positives = 32/57 (56%)
 Frame = +1

Query: 58  ELTKKIPKKKPPRVEDTRSKKEHVNVVFIGHVDAGKSTIGGQIMSLTGMVDKRTLEK 228
           E+ K++ KKK  ++E T        V+ +G  ++GKST+  Q+ ++TG   K  L +
Sbjct: 22  EIEKQLEKKKNMQLEQT--------VLLLGPGESGKSTVMKQMRAMTGNYTKTELHE 70


>AY008132-1|AAG32085.1|  356|Caenorhabditis elegans heterotrimeric G
           protein alphasubunit protein.
          Length = 356

 Score = 29.5 bits (63), Expect = 2.5
 Identities = 18/57 (31%), Positives = 32/57 (56%)
 Frame = +1

Query: 58  ELTKKIPKKKPPRVEDTRSKKEHVNVVFIGHVDAGKSTIGGQIMSLTGMVDKRTLEK 228
           E+ K++ KKK  ++E T        V+ +G  ++GKST+  Q+ ++TG   K  L +
Sbjct: 22  EIEKQLEKKKNMQLEQT--------VLLLGPGESGKSTVMKQMRAMTGNYTKTELHE 70


>AF036692-9|AAB88330.1|  389|Caenorhabditis elegans Hypothetical
           protein C44B12.7 protein.
          Length = 389

 Score = 29.5 bits (63), Expect = 2.5
 Identities = 14/39 (35%), Positives = 19/39 (48%)
 Frame = -3

Query: 398 KTFVSRGIKNCKMLLFSLKISSSNFYCFAFVSFFLICVQ 282
           K  VS  +  CK LL S K     FYC  F ++ L  ++
Sbjct: 213 KKIVSLALLRCKQLLKSFKSLCPEFYCNLFKTYILPLIE 251


>AC006714-2|AAK29716.2|  689|Caenorhabditis elegans Hypothetical
           protein Y119D3B.14 protein.
          Length = 689

 Score = 29.1 bits (62), Expect = 3.4
 Identities = 11/26 (42%), Positives = 18/26 (69%)
 Frame = +1

Query: 130 NVVFIGHVDAGKSTIGGQIMSLTGMV 207
           N+  I HVDAGK+T+  +++ L G +
Sbjct: 27  NIGVIAHVDAGKTTVTERLLYLAGAI 52


>Z93394-1|CAB07703.1|  369|Caenorhabditis elegans Hypothetical
           protein Y48E1C.2 protein.
          Length = 369

 Score = 28.3 bits (60), Expect = 5.9
 Identities = 12/21 (57%), Positives = 16/21 (76%)
 Frame = +2

Query: 212 KEH*KNMKEKRERNQRIMVLI 274
           KEH +NMKEK E N +I+ +I
Sbjct: 60  KEHIRNMKEKVEHNSQILRMI 80


>U50193-2|AAA91248.1|  974|Caenorhabditis elegans Elongation factor
           protein 1 protein.
          Length = 974

 Score = 28.3 bits (60), Expect = 5.9
 Identities = 12/33 (36%), Positives = 18/33 (54%)
 Frame = +3

Query: 369 ILDAPGHKSFVPNMIGGAAQADLAVLVISARKG 467
           I+D PGH +F   M      AD  V+++ A +G
Sbjct: 205 IIDTPGHVNFSDEMTASYRLADGVVVMVDAHEG 237


>M86958-1|AAA21824.1|  849|Caenorhabditis elegans eft-1 protein.
          Length = 849

 Score = 28.3 bits (60), Expect = 5.9
 Identities = 12/33 (36%), Positives = 18/33 (54%)
 Frame = +3

Query: 369 ILDAPGHKSFVPNMIGGAAQADLAVLVISARKG 467
           I+D PGH +F   M      AD  V+++ A +G
Sbjct: 80  IIDTPGHVNFSDEMTASYRLADGVVVMVDAHEG 112


>AY125085-1|AAM94369.1| 1113|Caenorhabditis elegans regulatory
            cytoplasmic polyA polymeraseprotein.
          Length = 1113

 Score = 28.3 bits (60), Expect = 5.9
 Identities = 12/35 (34%), Positives = 20/35 (57%)
 Frame = +1

Query: 16   LDTQVGNTNPNEDGELTKKIPKKKPPRVEDTRSKK 120
            +D +  N+N  +DG  TK+ P  + P    T+S+K
Sbjct: 1069 VDKKQQNSNRKDDGNRTKRSPMVQSPEPAKTKSEK 1103


>AF024497-5|AAO21477.1|  871|Caenorhabditis elegans Defective in
           germ line developmentprotein 2, isoform b protein.
          Length = 871

 Score = 28.3 bits (60), Expect = 5.9
 Identities = 12/35 (34%), Positives = 20/35 (57%)
 Frame = +1

Query: 16  LDTQVGNTNPNEDGELTKKIPKKKPPRVEDTRSKK 120
           +D +  N+N  +DG  TK+ P  + P    T+S+K
Sbjct: 827 VDKKQQNSNRKDDGNRTKRSPMVQSPEPAKTKSEK 861


>AF024497-4|AAO21479.1|  807|Caenorhabditis elegans Defective in
           germ line developmentprotein 2, isoform d protein.
          Length = 807

 Score = 28.3 bits (60), Expect = 5.9
 Identities = 12/35 (34%), Positives = 20/35 (57%)
 Frame = +1

Query: 16  LDTQVGNTNPNEDGELTKKIPKKKPPRVEDTRSKK 120
           +D +  N+N  +DG  TK+ P  + P    T+S+K
Sbjct: 763 VDKKQQNSNRKDDGNRTKRSPMVQSPEPAKTKSEK 797


>AF024497-3|AAO21478.1| 1036|Caenorhabditis elegans Defective in germ
            line developmentprotein 2, isoform c protein.
          Length = 1036

 Score = 28.3 bits (60), Expect = 5.9
 Identities = 12/35 (34%), Positives = 20/35 (57%)
 Frame = +1

Query: 16   LDTQVGNTNPNEDGELTKKIPKKKPPRVEDTRSKK 120
            +D +  N+N  +DG  TK+ P  + P    T+S+K
Sbjct: 992  VDKKQQNSNRKDDGNRTKRSPMVQSPEPAKTKSEK 1026


>AF024497-2|AAB70342.2| 1113|Caenorhabditis elegans Defective in germ
            line developmentprotein 2, isoform a protein.
          Length = 1113

 Score = 28.3 bits (60), Expect = 5.9
 Identities = 12/35 (34%), Positives = 20/35 (57%)
 Frame = +1

Query: 16   LDTQVGNTNPNEDGELTKKIPKKKPPRVEDTRSKK 120
            +D +  N+N  +DG  TK+ P  + P    T+S+K
Sbjct: 1069 VDKKQQNSNRKDDGNRTKRSPMVQSPEPAKTKSEK 1103


>AF003386-9|AAB54259.1| 1621|Caenorhabditis elegans Hypothetical
           protein F59E12.9 protein.
          Length = 1621

 Score = 28.3 bits (60), Expect = 5.9
 Identities = 23/96 (23%), Positives = 41/96 (42%), Gaps = 1/96 (1%)
 Frame = +1

Query: 7   EEELDTQVGNTNPNEDGELTKKIPKKKPPRVEDTR-SKKEHVNVVFIGHVDAGKSTIGGQ 183
           E E + +       +   L+K IPKKKP      R + + H+    +  +D  K   G  
Sbjct: 436 EAEREKEKAKDREKKIAALSKPIPKKKPETTNSLRQANRTHMETAVVARIDRMKLK-GID 494

Query: 184 IMSLTGMVDKRTLEKYEREAREKSENHGTYHGHWTQ 291
              +  +VD+  LE+   +  +++ +H  Y   W Q
Sbjct: 495 RKEMKDLVDQ--LEEMLFDKCDRNISHPKYR-VWKQ 527


>Z81068-5|CAB02985.1|  852|Caenorhabditis elegans Hypothetical
           protein F25H5.4 protein.
          Length = 852

 Score = 27.9 bits (59), Expect = 7.8
 Identities = 12/31 (38%), Positives = 19/31 (61%)
 Frame = +1

Query: 115 KKEHVNVVFIGHVDAGKSTIGGQIMSLTGMV 207
           K+   N+  I HVD GKST+   ++S  G++
Sbjct: 16  KRNIRNMSVIAHVDHGKSTLTDSLVSKAGII 46


>M86959-1|AAD03339.1|  852|Caenorhabditis elegans elongation factor
           protein.
          Length = 852

 Score = 27.9 bits (59), Expect = 7.8
 Identities = 12/31 (38%), Positives = 19/31 (61%)
 Frame = +1

Query: 115 KKEHVNVVFIGHVDAGKSTIGGQIMSLTGMV 207
           K+   N+  I HVD GKST+   ++S  G++
Sbjct: 16  KRNIRNMSVIAHVDHGKSTLTDSLVSKAGII 46


>AC006695-8|AAF39976.1|  351|Caenorhabditis elegans Hypothetical
           protein W06H8.4 protein.
          Length = 351

 Score = 27.9 bits (59), Expect = 7.8
 Identities = 10/25 (40%), Positives = 16/25 (64%)
 Frame = -2

Query: 174 NSRLSCIYMSYKYYIYMFFFASCIF 100
           N  L  +Y+SY + ++ F FAS +F
Sbjct: 223 NPELCSVYLSYYHVVFSFTFASLLF 247


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 16,069,405
Number of Sequences: 27780
Number of extensions: 323236
Number of successful extensions: 1349
Number of sequences better than 10.0: 38
Number of HSP's better than 10.0 without gapping: 1262
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1349
length of database: 12,740,198
effective HSP length: 79
effective length of database: 10,545,578
effective search space used: 1697838058
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -