SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20008
         (705 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AC006729-4|AAK84600.1|  265|Caenorhabditis elegans Ribosomal pro...    85   4e-17
AC006729-3|AAM15612.1|  245|Caenorhabditis elegans Ribosomal pro...    77   2e-14
AC084159-4|AAK39366.1|  234|Caenorhabditis elegans Hypothetical ...    76   2e-14
AC084159-5|AAM69075.1|  199|Caenorhabditis elegans Hypothetical ...    56   3e-08
AF016444-5|AAB65932.1|  330|Caenorhabditis elegans Serpentine re...    36   0.028
Z49911-4|CAA90127.1|  128|Caenorhabditis elegans Hypothetical pr...    32   0.35 
U32275-1|AAA75370.1|  982|Caenorhabditis elegans serine-threonin...    29   3.2  
U11280-5|AAA19437.1|  982|Caenorhabditis elegans Protein kinase ...    29   3.2  
AC024810-8|AAU20830.1| 1446|Caenorhabditis elegans Hypothetical ...    29   3.2  
U39850-6|AAM45366.1| 1081|Caenorhabditis elegans Polyq (poly glu...    28   5.7  
U39850-3|AAM45367.2| 1647|Caenorhabditis elegans Polyq (poly glu...    28   5.7  
U23486-3|AAL38955.1|  529|Caenorhabditis elegans Hypothetical pr...    28   7.5  

>AC006729-4|AAK84600.1|  265|Caenorhabditis elegans Ribosomal
           protein, large subunitprotein 7A, isoform a protein.
          Length = 265

 Score = 85.4 bits (202), Expect = 4e-17
 Identities = 41/92 (44%), Positives = 52/92 (56%)
 Frame = +3

Query: 234 LVQICKMPKYIRIQRQKAVLQRRLKVPPPINQFTQTLDKTTAKGLFKILEKYRPETXXXX 413
           + +  K PKYIR+QRQ A+LQ+RLKVPP INQF   LD  +A+  FK+L+KYRPE+    
Sbjct: 52  VTRFVKWPKYIRLQRQSAILQKRLKVPPTINQFRTALDSQSARQAFKLLDKYRPESTEAK 111

Query: 414 XXXXXXXXXXXXXXXXXXXXXRPNTIRSGTNT 509
                                RPNT+R G NT
Sbjct: 112 KNRLRARAEARAAGKKEEVTKRPNTVRHGVNT 143



 Score = 66.9 bits (156), Expect = 1e-11
 Identities = 35/72 (48%), Positives = 46/72 (63%), Gaps = 2/72 (2%)
 Frame = +2

Query: 494 IRH--KHVTKLVEKKKAQLWSSLMMLIPLSWFLFLPALCRKMGVPYCIVKGKSRLGALVH 667
           +RH    +T+LVE ++AQL      + PL   L LPALCRK  VPY I+KGK+ LG +V 
Sbjct: 137 VRHGVNTITRLVETRRAQLVLIAHDVNPLEIVLHLPALCRKYNVPYAIIKGKASLGTVVR 196

Query: 668 RKTCTCLALTNV 703
           RKT   +AL +V
Sbjct: 197 RKTTAAVALVDV 208



 Score = 48.4 bits (110), Expect = 5e-06
 Identities = 20/30 (66%), Positives = 25/30 (83%)
 Frame = +1

Query: 169 NPLFEKRPKNFAIGQGIQPTRDLSRFVRCP 258
           NPLFEKR +NF IGQ IQP +D++RFV+ P
Sbjct: 30  NPLFEKRARNFNIGQDIQPKKDVTRFVKWP 59


>AC006729-3|AAM15612.1|  245|Caenorhabditis elegans Ribosomal
           protein, large subunitprotein 7A, isoform c protein.
          Length = 245

 Score = 76.6 bits (180), Expect = 2e-14
 Identities = 33/56 (58%), Positives = 43/56 (76%)
 Frame = +3

Query: 234 LVQICKMPKYIRIQRQKAVLQRRLKVPPPINQFTQTLDKTTAKGLFKILEKYRPET 401
           + +  K PKYIR+QRQ A+LQ+RLKVPP INQF   LD  +A+  FK+L+KYRPE+
Sbjct: 52  VTRFVKWPKYIRLQRQSAILQKRLKVPPTINQFRTALDSQSARQAFKLLDKYRPES 107



 Score = 66.9 bits (156), Expect = 1e-11
 Identities = 35/72 (48%), Positives = 46/72 (63%), Gaps = 2/72 (2%)
 Frame = +2

Query: 494 IRH--KHVTKLVEKKKAQLWSSLMMLIPLSWFLFLPALCRKMGVPYCIVKGKSRLGALVH 667
           +RH    +T+LVE ++AQL      + PL   L LPALCRK  VPY I+KGK+ LG +V 
Sbjct: 117 VRHGVNTITRLVETRRAQLVLIAHDVNPLEIVLHLPALCRKYNVPYAIIKGKASLGTVVR 176

Query: 668 RKTCTCLALTNV 703
           RKT   +AL +V
Sbjct: 177 RKTTAAVALVDV 188



 Score = 48.4 bits (110), Expect = 5e-06
 Identities = 20/30 (66%), Positives = 25/30 (83%)
 Frame = +1

Query: 169 NPLFEKRPKNFAIGQGIQPTRDLSRFVRCP 258
           NPLFEKR +NF IGQ IQP +D++RFV+ P
Sbjct: 30  NPLFEKRARNFNIGQDIQPKKDVTRFVKWP 59


>AC084159-4|AAK39366.1|  234|Caenorhabditis elegans Hypothetical
           protein Y73B3A.18a protein.
          Length = 234

 Score = 76.2 bits (179), Expect = 2e-14
 Identities = 33/56 (58%), Positives = 43/56 (76%)
 Frame = +3

Query: 234 LVQICKMPKYIRIQRQKAVLQRRLKVPPPINQFTQTLDKTTAKGLFKILEKYRPET 401
           + +  K PKYIR+QRQ A+LQ+RLKVPP INQF   LD  +A+  FK+L+KYRPE+
Sbjct: 155 VTRFVKWPKYIRLQRQSAILQKRLKVPPTINQFRTALDSHSARQAFKLLDKYRPES 210



 Score = 48.4 bits (110), Expect = 5e-06
 Identities = 20/30 (66%), Positives = 25/30 (83%)
 Frame = +1

Query: 169 NPLFEKRPKNFAIGQGIQPTRDLSRFVRCP 258
           NPLFEKR +NF IGQ IQP +D++RFV+ P
Sbjct: 133 NPLFEKRARNFNIGQDIQPKKDVTRFVKWP 162


>AC084159-5|AAM69075.1|  199|Caenorhabditis elegans Hypothetical
           protein Y73B3A.18b protein.
          Length = 199

 Score = 55.6 bits (128), Expect = 3e-08
 Identities = 24/38 (63%), Positives = 29/38 (76%)
 Frame = +3

Query: 234 LVQICKMPKYIRIQRQKAVLQRRLKVPPPINQFTQTLD 347
           + +  K PKYIR+QRQ A+LQ+RLKVPP INQF   LD
Sbjct: 155 VTRFVKWPKYIRLQRQSAILQKRLKVPPTINQFRTALD 192



 Score = 48.4 bits (110), Expect = 5e-06
 Identities = 20/30 (66%), Positives = 25/30 (83%)
 Frame = +1

Query: 169 NPLFEKRPKNFAIGQGIQPTRDLSRFVRCP 258
           NPLFEKR +NF IGQ IQP +D++RFV+ P
Sbjct: 133 NPLFEKRARNFNIGQDIQPKKDVTRFVKWP 162


>AF016444-5|AAB65932.1|  330|Caenorhabditis elegans Serpentine
           receptor, class ab (class a-like) protein 6 protein.
          Length = 330

 Score = 35.9 bits (79), Expect = 0.028
 Identities = 17/43 (39%), Positives = 29/43 (67%), Gaps = 3/43 (6%)
 Frame = -2

Query: 443 SFSSFP--QPLFPGCFSLRPVFLQNLEKA-LSCSLVQCLGKLV 324
           SF SFP  QP+   C +++P F+ N+EKA + C ++Q  G+++
Sbjct: 163 SFLSFPFSQPVMNYCTAVKPGFVTNIEKAFIGCLIIQIGGRII 205


>Z49911-4|CAA90127.1|  128|Caenorhabditis elegans Hypothetical
           protein M28.5 protein.
          Length = 128

 Score = 32.3 bits (70), Expect = 0.35
 Identities = 14/29 (48%), Positives = 16/29 (55%)
 Frame = +2

Query: 569 PLSWFLFLPALCRKMGVPYCIVKGKSRLG 655
           PL   L LP LC    VPY  V+ K+ LG
Sbjct: 62  PLEILLHLPLLCEDKNVPYVFVRSKAALG 90


>U32275-1|AAA75370.1|  982|Caenorhabditis elegans serine-threonine
           kinase protein.
          Length = 982

 Score = 29.1 bits (62), Expect = 3.2
 Identities = 11/32 (34%), Positives = 19/32 (59%)
 Frame = +1

Query: 481 PTPSDPAQTRHQAGREEEGAVVVIAHDVDPIE 576
           P+PS+P  T     + E  +++  AHD DP++
Sbjct: 453 PSPSEPIPTSQPTSKSESSSILETAHD-DPLD 483


>U11280-5|AAA19437.1|  982|Caenorhabditis elegans Protein kinase
           protein 18, isoforma protein.
          Length = 982

 Score = 29.1 bits (62), Expect = 3.2
 Identities = 11/32 (34%), Positives = 19/32 (59%)
 Frame = +1

Query: 481 PTPSDPAQTRHQAGREEEGAVVVIAHDVDPIE 576
           P+PS+P  T     + E  +++  AHD DP++
Sbjct: 453 PSPSEPIPTSQPTSKSESSSILETAHD-DPLD 483


>AC024810-8|AAU20830.1| 1446|Caenorhabditis elegans Hypothetical
           protein Y54E10A.11 protein.
          Length = 1446

 Score = 29.1 bits (62), Expect = 3.2
 Identities = 22/74 (29%), Positives = 32/74 (43%)
 Frame = +3

Query: 159 EDRESSLREEAKELCHWSGHSANSGLVQICKMPKYIRIQRQKAVLQRRLKVPPPINQFTQ 338
           + RE  L+E   EL +    S  S     C +   +       V    +KV   I+QF  
Sbjct: 71  QTREKGLKE-LMELINTENSSIESSYEHFCGLVAQLTTDGSPTVRMLTMKV---ISQFLT 126

Query: 339 TLDKTTAKGLFKIL 380
            L K+ +KGL KI+
Sbjct: 127 KLKKSASKGLKKII 140


>U39850-6|AAM45366.1| 1081|Caenorhabditis elegans Polyq (poly
           glutamine tract) toxicityenhancer protein 1, isoform a
           protein.
          Length = 1081

 Score = 28.3 bits (60), Expect = 5.7
 Identities = 17/46 (36%), Positives = 19/46 (41%), Gaps = 1/46 (2%)
 Frame = +2

Query: 194 RTLPLVRAFSQLGTCPDL*DAQVY-PHPAPEGCTSASSESAPSDQP 328
           +T P+ R  S      DL  A VY P P PEG T          QP
Sbjct: 66  KTEPVARQVSTAQMKRDLEQAAVYVPTPIPEGSTQPQQRQQQQSQP 111


>U39850-3|AAM45367.2| 1647|Caenorhabditis elegans Polyq (poly
           glutamine tract) toxicityenhancer protein 1, isoform b
           protein.
          Length = 1647

 Score = 28.3 bits (60), Expect = 5.7
 Identities = 17/46 (36%), Positives = 19/46 (41%), Gaps = 1/46 (2%)
 Frame = +2

Query: 194 RTLPLVRAFSQLGTCPDL*DAQVY-PHPAPEGCTSASSESAPSDQP 328
           +T P+ R  S      DL  A VY P P PEG T          QP
Sbjct: 66  KTEPVARQVSTAQMKRDLEQAAVYVPTPIPEGSTQPQQRQQQQSQP 111


>U23486-3|AAL38955.1|  529|Caenorhabditis elegans Hypothetical
           protein F07F6.4 protein.
          Length = 529

 Score = 27.9 bits (59), Expect = 7.5
 Identities = 12/17 (70%), Positives = 14/17 (82%)
 Frame = +1

Query: 316 LRSTNLPRHWTRLQLRA 366
           +RSTNL  +WT LQLRA
Sbjct: 65  VRSTNLDTNWTWLQLRA 81


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 15,220,745
Number of Sequences: 27780
Number of extensions: 301967
Number of successful extensions: 929
Number of sequences better than 10.0: 12
Number of HSP's better than 10.0 without gapping: 869
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 925
length of database: 12,740,198
effective HSP length: 79
effective length of database: 10,545,578
effective search space used: 1634564590
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -