SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20007
         (719 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z82059-6|CAB04874.1|  300|Caenorhabditis elegans Hypothetical pr...   125   3e-29
X76112-1|CAA53718.1|  300|Caenorhabditis elegans ADP/ATP translo...   125   3e-29
Z82059-8|CAD89757.1|  207|Caenorhabditis elegans Hypothetical pr...   125   4e-29
Z68218-2|CAA92472.1|  313|Caenorhabditis elegans Hypothetical pr...   124   5e-29
U80931-5|AAB38001.1|  313|Caenorhabditis elegans Hypothetical pr...   124   5e-29
AF003141-4|AAK21485.1|  300|Caenorhabditis elegans Hypothetical ...   124   6e-29
Z68882-2|CAA93110.1|  306|Caenorhabditis elegans Hypothetical pr...    93   1e-19
Z82059-7|CAD89756.1|  128|Caenorhabditis elegans Hypothetical pr...    89   2e-18
U64842-4|AAB37086.2|  306|Caenorhabditis elegans Hypothetical pr...    87   9e-18
Z49207-2|CAA89069.1|  298|Caenorhabditis elegans Hypothetical pr...    77   1e-14
U00052-8|AAK21421.2|  707|Caenorhabditis elegans Hypothetical pr...    43   2e-04
Z50873-3|CAA90761.4|  531|Caenorhabditis elegans Hypothetical pr...    39   0.003
Z75532-5|CAD56651.1|  360|Caenorhabditis elegans Hypothetical pr...    37   0.017
Z75532-4|CAA99811.1|  310|Caenorhabditis elegans Hypothetical pr...    37   0.017
AF003384-5|AAB54239.2|  324|Caenorhabditis elegans Uncoupling pr...    37   0.017
Z78542-7|CAB01750.1|  300|Caenorhabditis elegans Hypothetical pr...    36   0.038
Z70310-10|CAA94371.2|  341|Caenorhabditis elegans Hypothetical p...    33   0.16 
AL023841-13|CAA19513.2|  341|Caenorhabditis elegans Hypothetical...    33   0.16 
CU457741-10|CAM36351.1|  313|Caenorhabditis elegans Hypothetical...    33   0.21 
Z79755-2|CAB02107.1|  294|Caenorhabditis elegans Hypothetical pr...    33   0.27 
Z49068-10|CAA88858.1|  296|Caenorhabditis elegans Hypothetical p...    33   0.27 
Z48240-1|CAA88283.1|  312|Caenorhabditis elegans DIF-1 protein.        32   0.36 
X76115-1|CAA53721.1|  312|Caenorhabditis elegans carrier protein...    32   0.36 
U61949-5|AAB03153.2|  312|Caenorhabditis elegans Differentiation...    32   0.36 
AF067608-15|AAO38679.1|  470|Caenorhabditis elegans Hypothetical...    31   1.1  
AF125451-12|AAP13764.1|  173|Caenorhabditis elegans Hypothetical...    30   1.4  
AF125451-11|AAP13763.1|  525|Caenorhabditis elegans Hypothetical...    30   1.4  
AF125451-10|AAD12819.2|  511|Caenorhabditis elegans Hypothetical...    30   1.4  
Z75955-5|CAB00119.2|  285|Caenorhabditis elegans Hypothetical pr...    30   1.9  
Z22180-4|CAA80178.1|  312|Caenorhabditis elegans Hypothetical pr...    30   1.9  
Z75539-1|CAA99843.1|  672|Caenorhabditis elegans Hypothetical pr...    28   7.7  
U80836-10|AAB37890.2|  306|Caenorhabditis elegans Hypothetical p...    28   7.7  

>Z82059-6|CAB04874.1|  300|Caenorhabditis elegans Hypothetical
           protein T27E9.1a protein.
          Length = 300

 Score =  125 bits (302), Expect = 3e-29
 Identities = 55/88 (62%), Positives = 64/88 (72%)
 Frame = +2

Query: 236 PQGAGSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYFXXXXXXXX 415
           P+  G  + WRGN ANVIRYFPTQA+NFAFKD YK +FL G+DKK  FW++F        
Sbjct: 66  PKEQGVAALWRGNLANVIRYFPTQAMNFAFKDTYKAIFLEGLDKKKDFWKFFAGNLASGG 125

Query: 416 XXXXTSLCFVYPLDFARTRLAADVGKGD 499
               TSLCFVYPLDFARTRLAAD+GK +
Sbjct: 126 AAGATSLCFVYPLDFARTRLAADIGKAN 153



 Score = 89.4 bits (212), Expect = 2e-18
 Identities = 43/64 (67%), Positives = 50/64 (78%)
 Frame = +3

Query: 63  DPVAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPK 242
           D   F  D  +GG +AAVSKTAVAPIERVKLLLQVQ  SK IA D+RYKGI+D  +R+PK
Sbjct: 8   DTKKFLIDLASGGTAAAVSKTAVAPIERVKLLLQVQDASKAIAVDKRYKGIMDVLIRVPK 67

Query: 243 EQGL 254
           EQG+
Sbjct: 68  EQGV 71



 Score = 40.3 bits (90), Expect = 0.001
 Identities = 17/24 (70%), Positives = 19/24 (79%)
 Frame = +1

Query: 511 FSGLGNCISKIFKSDGLIGLYRGF 582
           F GL +C+ KI KSDG IGLYRGF
Sbjct: 157 FKGLADCLIKIVKSDGPIGLYRGF 180



 Score = 31.9 bits (69), Expect = 0.47
 Identities = 16/38 (42%), Positives = 25/38 (65%), Gaps = 3/38 (7%)
 Frame = +3

Query: 543 LQVRRSDWSVQRFRCVRAS---IIIYRASYFGFYDTAR 647
           +++ +SD  +  +R    S   IIIYRA+YFG +DTA+
Sbjct: 165 IKIVKSDGPIGLYRGFFVSVQGIIIYRAAYFGMFDTAK 202


>X76112-1|CAA53718.1|  300|Caenorhabditis elegans ADP/ATP
           translocase protein.
          Length = 300

 Score =  125 bits (302), Expect = 3e-29
 Identities = 55/88 (62%), Positives = 64/88 (72%)
 Frame = +2

Query: 236 PQGAGSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYFXXXXXXXX 415
           P+  G  + WRGN ANVIRYFPTQA+NFAFKD YK +FL G+DKK  FW++F        
Sbjct: 66  PKEQGVAALWRGNLANVIRYFPTQAMNFAFKDTYKAIFLEGLDKKKDFWKFFAGNLASGG 125

Query: 416 XXXXTSLCFVYPLDFARTRLAADVGKGD 499
               TSLCFVYPLDFARTRLAAD+GK +
Sbjct: 126 AAGATSLCFVYPLDFARTRLAADIGKAN 153



 Score = 89.4 bits (212), Expect = 2e-18
 Identities = 43/64 (67%), Positives = 50/64 (78%)
 Frame = +3

Query: 63  DPVAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPK 242
           D   F  D  +GG +AAVSKTAVAPIERVKLLLQVQ  SK IA D+RYKGI+D  +R+PK
Sbjct: 8   DTKKFLIDLASGGTAAAVSKTAVAPIERVKLLLQVQDASKAIAVDKRYKGIMDVLIRVPK 67

Query: 243 EQGL 254
           EQG+
Sbjct: 68  EQGV 71



 Score = 40.3 bits (90), Expect = 0.001
 Identities = 17/24 (70%), Positives = 19/24 (79%)
 Frame = +1

Query: 511 FSGLGNCISKIFKSDGLIGLYRGF 582
           F GL +C+ KI KSDG IGLYRGF
Sbjct: 157 FKGLADCLIKIVKSDGPIGLYRGF 180



 Score = 31.9 bits (69), Expect = 0.47
 Identities = 16/38 (42%), Positives = 25/38 (65%), Gaps = 3/38 (7%)
 Frame = +3

Query: 543 LQVRRSDWSVQRFRCVRAS---IIIYRASYFGFYDTAR 647
           +++ +SD  +  +R    S   IIIYRA+YFG +DTA+
Sbjct: 165 IKIVKSDGPIGLYRGFFVSVQGIIIYRAAYFGMFDTAK 202


>Z82059-8|CAD89757.1|  207|Caenorhabditis elegans Hypothetical
           protein T27E9.1c protein.
          Length = 207

 Score =  125 bits (301), Expect = 4e-29
 Identities = 55/86 (63%), Positives = 63/86 (73%)
 Frame = +2

Query: 236 PQGAGSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYFXXXXXXXX 415
           P+  G  + WRGN ANVIRYFPTQA+NFAFKD YK +FL G+DKK  FW++F        
Sbjct: 66  PKEQGVAALWRGNLANVIRYFPTQAMNFAFKDTYKAIFLEGLDKKKDFWKFFAGNLASGG 125

Query: 416 XXXXTSLCFVYPLDFARTRLAADVGK 493
               TSLCFVYPLDFARTRLAAD+GK
Sbjct: 126 AAGATSLCFVYPLDFARTRLAADIGK 151



 Score = 89.4 bits (212), Expect = 2e-18
 Identities = 43/64 (67%), Positives = 50/64 (78%)
 Frame = +3

Query: 63  DPVAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPK 242
           D   F  D  +GG +AAVSKTAVAPIERVKLLLQVQ  SK IA D+RYKGI+D  +R+PK
Sbjct: 8   DTKKFLIDLASGGTAAAVSKTAVAPIERVKLLLQVQDASKAIAVDKRYKGIMDVLIRVPK 67

Query: 243 EQGL 254
           EQG+
Sbjct: 68  EQGV 71


>Z68218-2|CAA92472.1|  313|Caenorhabditis elegans Hypothetical
           protein K01H12.2 protein.
          Length = 313

 Score =  124 bits (300), Expect = 5e-29
 Identities = 56/88 (63%), Positives = 63/88 (71%)
 Frame = +2

Query: 236 PQGAGSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYFXXXXXXXX 415
           P+  G  + WRGN ANVIRYFPTQALNFAFKD YK +F  G+DKK  FW++F        
Sbjct: 79  PKEQGYAALWRGNLANVIRYFPTQALNFAFKDTYKNIFQKGLDKKKDFWKFFAGNLASGG 138

Query: 416 XXXXTSLCFVYPLDFARTRLAADVGKGD 499
               TSLCFVYPLDFARTRLAADVGK +
Sbjct: 139 AAGATSLCFVYPLDFARTRLAADVGKAN 166



 Score = 89.0 bits (211), Expect = 3e-18
 Identities = 45/63 (71%), Positives = 49/63 (77%)
 Frame = +3

Query: 63  DPVAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPK 242
           D   F  D  +GG +AAVSKTAVAPIERVKLLLQVQ  S  IAAD+RYKGIVD  VR+PK
Sbjct: 21  DTRKFLIDLASGGTAAAVSKTAVAPIERVKLLLQVQDASLTIAADKRYKGIVDVLVRVPK 80

Query: 243 EQG 251
           EQG
Sbjct: 81  EQG 83



 Score = 39.9 bits (89), Expect = 0.002
 Identities = 17/24 (70%), Positives = 19/24 (79%)
 Frame = +1

Query: 511 FSGLGNCISKIFKSDGLIGLYRGF 582
           F GL +C+ KI KSDG IGLYRGF
Sbjct: 170 FKGLADCLVKIAKSDGPIGLYRGF 193



 Score = 34.7 bits (76), Expect = 0.067
 Identities = 20/55 (36%), Positives = 31/55 (56%), Gaps = 4/55 (7%)
 Frame = +3

Query: 543 LQVRRSDWSVQRFRCVRAS---IIIYRASYFGFYDTARGML-PDPKNTPIVISWA 695
           +++ +SD  +  +R    S   IIIYRA+YFG +DTA+ +   D K      +WA
Sbjct: 178 VKIAKSDGPIGLYRGFFVSVQGIIIYRAAYFGMFDTAKMVFTADGKKLNFFAAWA 232


>U80931-5|AAB38001.1|  313|Caenorhabditis elegans Hypothetical
           protein T01B11.4 protein.
          Length = 313

 Score =  124 bits (300), Expect = 5e-29
 Identities = 56/88 (63%), Positives = 63/88 (71%)
 Frame = +2

Query: 236 PQGAGSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYFXXXXXXXX 415
           P+  G  + WRGN ANVIRYFPTQALNFAFKD YK +F  G+DKK  FW++F        
Sbjct: 79  PKEQGYAALWRGNLANVIRYFPTQALNFAFKDTYKNIFQKGLDKKKDFWKFFAGNLASGG 138

Query: 416 XXXXTSLCFVYPLDFARTRLAADVGKGD 499
               TSLCFVYPLDFARTRLAADVGK +
Sbjct: 139 AAGATSLCFVYPLDFARTRLAADVGKAN 166



 Score = 89.0 bits (211), Expect = 3e-18
 Identities = 45/63 (71%), Positives = 49/63 (77%)
 Frame = +3

Query: 63  DPVAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPK 242
           D   F  D  +GG +AAVSKTAVAPIERVKLLLQVQ  S  IAAD+RYKGIVD  VR+PK
Sbjct: 21  DTRKFLIDLASGGTAAAVSKTAVAPIERVKLLLQVQDASLTIAADKRYKGIVDVLVRVPK 80

Query: 243 EQG 251
           EQG
Sbjct: 81  EQG 83



 Score = 39.9 bits (89), Expect = 0.002
 Identities = 17/24 (70%), Positives = 19/24 (79%)
 Frame = +1

Query: 511 FSGLGNCISKIFKSDGLIGLYRGF 582
           F GL +C+ KI KSDG IGLYRGF
Sbjct: 170 FKGLADCLVKIAKSDGPIGLYRGF 193



 Score = 34.7 bits (76), Expect = 0.067
 Identities = 20/55 (36%), Positives = 31/55 (56%), Gaps = 4/55 (7%)
 Frame = +3

Query: 543 LQVRRSDWSVQRFRCVRAS---IIIYRASYFGFYDTARGML-PDPKNTPIVISWA 695
           +++ +SD  +  +R    S   IIIYRA+YFG +DTA+ +   D K      +WA
Sbjct: 178 VKIAKSDGPIGLYRGFFVSVQGIIIYRAAYFGMFDTAKMVFTADGKKLNFFAAWA 232


>AF003141-4|AAK21485.1|  300|Caenorhabditis elegans Hypothetical
           protein W02D3.6 protein.
          Length = 300

 Score =  124 bits (299), Expect = 6e-29
 Identities = 54/87 (62%), Positives = 63/87 (72%)
 Frame = +2

Query: 236 PQGAGSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYFXXXXXXXX 415
           P+  G  +FWRGN ANV+RYFPTQALNFAFKD YK++F  G+DK  +FW++F        
Sbjct: 66  PKEQGYAAFWRGNLANVLRYFPTQALNFAFKDTYKKMFQEGIDKNKEFWKFFAGNLASGG 125

Query: 416 XXXXTSLCFVYPLDFARTRLAADVGKG 496
               TSLCFVYPLDF RTRL ADVGKG
Sbjct: 126 AAGATSLCFVYPLDFVRTRLGADVGKG 152



 Score = 83.4 bits (197), Expect = 1e-16
 Identities = 38/59 (64%), Positives = 47/59 (79%)
 Frame = +3

Query: 75  FAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQG 251
           F  D  +GG +AA+SKTAVAPIERVKLLLQV  VS+ + AD++YKGI+D   R+PKEQG
Sbjct: 12  FLVDLASGGTAAAISKTAVAPIERVKLLLQVSDVSETVTADKKYKGIMDVLARVPKEQG 70



 Score = 38.7 bits (86), Expect = 0.004
 Identities = 17/24 (70%), Positives = 18/24 (75%)
 Frame = +1

Query: 511 FSGLGNCISKIFKSDGLIGLYRGF 582
           F GL +C  KI KSDG IGLYRGF
Sbjct: 157 FQGLTDCFVKIVKSDGPIGLYRGF 180



 Score = 32.7 bits (71), Expect = 0.27
 Identities = 15/33 (45%), Positives = 21/33 (63%), Gaps = 1/33 (3%)
 Frame = +3

Query: 600 IIIYRASYFGFYDTARGML-PDPKNTPIVISWA 695
           IIIYRA+YFG +DTA+ +   D +      +WA
Sbjct: 187 IIIYRAAYFGMFDTAKTLYSTDGQKLNFFTTWA 219


>Z68882-2|CAA93110.1|  306|Caenorhabditis elegans Hypothetical
           protein C47E12.2 protein.
          Length = 306

 Score = 93.5 bits (222), Expect = 1e-19
 Identities = 44/64 (68%), Positives = 52/64 (81%)
 Frame = +3

Query: 60  ADPVAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIP 239
           +D   FA D L GG+SA+VSKT VAPIERVK+LLQVQ+  K I AD+RY GI+DAFVR+P
Sbjct: 16  SDAQKFAIDLLIGGVSASVSKTVVAPIERVKILLQVQYSHKDIPADKRYNGIIDAFVRVP 75

Query: 240 KEQG 251
           KEQG
Sbjct: 76  KEQG 79



 Score = 92.7 bits (220), Expect = 2e-19
 Identities = 42/84 (50%), Positives = 51/84 (60%)
 Frame = +2

Query: 236 PQGAGSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYFXXXXXXXX 415
           P+  G +SFWRGN  NVIRYFPTQA NFAF D YK + L  + ++     Y         
Sbjct: 75  PKEQGFVSFWRGNMTNVIRYFPTQAFNFAFNDLYKSILLKNMKRENNVLSYSVRTLVSGG 134

Query: 416 XXXXTSLCFVYPLDFARTRLAADV 487
               +SLC VYPLDF RTRL+AD+
Sbjct: 135 LAGCSSLCIVYPLDFIRTRLSADI 158



 Score = 29.5 bits (63), Expect = 2.5
 Identities = 14/31 (45%), Positives = 17/31 (54%), Gaps = 1/31 (3%)
 Frame = +3

Query: 606 IYRASYFGFYDTARGML-PDPKNTPIVISWA 695
           IYR+ YFG YD  R  +  D K  P   S+A
Sbjct: 198 IYRSVYFGLYDAIRNTINTDKKKLPFYASFA 228



 Score = 28.7 bits (61), Expect = 4.4
 Identities = 16/59 (27%), Positives = 31/59 (52%), Gaps = 2/59 (3%)
 Frame = +3

Query: 81  KDFLAGGISAAVSKTAVAPIE--RVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQG 251
           +  ++GG++   S   V P++  R +L   + H +K+      YKG+VD  ++  K +G
Sbjct: 128 RTLVSGGLAGCSSLCIVYPLDFIRTRLSADINHHTKR-----EYKGLVDCTMKTVKNEG 181



 Score = 28.7 bits (61), Expect = 4.4
 Identities = 11/24 (45%), Positives = 15/24 (62%)
 Frame = +1

Query: 511 FSGLGNCISKIFKSDGLIGLYRGF 582
           + GL +C  K  K++G   LYRGF
Sbjct: 166 YKGLVDCTMKTVKNEGFSALYRGF 189


>Z82059-7|CAD89756.1|  128|Caenorhabditis elegans Hypothetical
           protein T27E9.1b protein.
          Length = 128

 Score = 89.4 bits (212), Expect = 2e-18
 Identities = 43/64 (67%), Positives = 50/64 (78%)
 Frame = +3

Query: 63  DPVAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPK 242
           D   F  D  +GG +AAVSKTAVAPIERVKLLLQVQ  SK IA D+RYKGI+D  +R+PK
Sbjct: 8   DTKKFLIDLASGGTAAAVSKTAVAPIERVKLLLQVQDASKAIAVDKRYKGIMDVLIRVPK 67

Query: 243 EQGL 254
           EQG+
Sbjct: 68  EQGV 71



 Score = 40.3 bits (90), Expect = 0.001
 Identities = 16/24 (66%), Positives = 18/24 (75%)
 Frame = +2

Query: 236 PQGAGSLSFWRGNFANVIRYFPTQ 307
           P+  G  + WRGN ANVIRYFPTQ
Sbjct: 66  PKEQGVAALWRGNLANVIRYFPTQ 89


>U64842-4|AAB37086.2|  306|Caenorhabditis elegans Hypothetical
           protein F25B4.7 protein.
          Length = 306

 Score = 87.4 bits (207), Expect = 9e-18
 Identities = 36/63 (57%), Positives = 51/63 (80%)
 Frame = +3

Query: 63  DPVAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPK 242
           D + F+KDF+AG  +AA+SKT +AP+ERVKL+LQ+Q+    +A + RYKGIVD F+R+P+
Sbjct: 14  DVIKFSKDFMAGATAAAISKTVIAPVERVKLILQLQNSQTTLALENRYKGIVDCFIRVPR 73

Query: 243 EQG 251
           EQG
Sbjct: 74  EQG 76



 Score = 77.8 bits (183), Expect = 7e-15
 Identities = 37/91 (40%), Positives = 52/91 (57%)
 Frame = +2

Query: 236 PQGAGSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYFXXXXXXXX 415
           P+  G LSFWRGN+ N++R    ++L  +FK+ +++  L GVD KTQ  R+         
Sbjct: 72  PREQGFLSFWRGNWVNILRSCSQESLGLSFKEFFRKYSLEGVDPKTQHSRWLVGNLVAGG 131

Query: 416 XXXXTSLCFVYPLDFARTRLAADVGKGDGQR 508
                +L  +YPLDF RTRLA D+GK    R
Sbjct: 132 GSGCATLATIYPLDFIRTRLAIDLGKRKSDR 162



 Score = 33.9 bits (74), Expect = 0.12
 Identities = 13/23 (56%), Positives = 18/23 (78%)
 Frame = +1

Query: 511 FSGLGNCISKIFKSDGLIGLYRG 579
           F+G+ +C  KI KSDG+ GLY+G
Sbjct: 164 FTGMFDCAKKIIKSDGVPGLYKG 186


>Z49207-2|CAA89069.1|  298|Caenorhabditis elegans Hypothetical
           protein R07E3.4 protein.
          Length = 298

 Score = 77.4 bits (182), Expect = 1e-14
 Identities = 38/87 (43%), Positives = 48/87 (55%)
 Frame = +2

Query: 248 GSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYFXXXXXXXXXXXX 427
           G+++ WRGN A V R  P   LNFAF+D Y+   L  VD+   F ++             
Sbjct: 69  GAMALWRGNGAGVARCLPNHTLNFAFRDIYRNTLLKNVDRNESFGKFLAGTFVSGGLGGA 128

Query: 428 TSLCFVYPLDFARTRLAADVGKGDGQR 508
           T+L  +YP DFARTRLA DV K DG R
Sbjct: 129 TTLFMLYPFDFARTRLALDV-KKDGSR 154



 Score = 51.6 bits (118), Expect = 5e-07
 Identities = 29/63 (46%), Positives = 39/63 (61%)
 Frame = +3

Query: 63  DPVAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPK 242
           D +  +K  LAG  +AA+SKT  AP +RVKL+LQ+Q  S+   A+  Y GI D   +I  
Sbjct: 9   DVLETSKKCLAGSAAAAISKTTTAPFDRVKLVLQLQRQSEFAMAE--YNGIRDCISKIRL 66

Query: 243 EQG 251
           EQG
Sbjct: 67  EQG 69



 Score = 30.7 bits (66), Expect = 1.1
 Identities = 12/32 (37%), Positives = 18/32 (56%)
 Frame = +3

Query: 600 IIIYRASYFGFYDTARGMLPDPKNTPIVISWA 695
           +I  RA +FG +D+ R  + DPK+      WA
Sbjct: 186 VIASRAIFFGIFDSIRTSVEDPKSLNFAACWA 217


>U00052-8|AAK21421.2|  707|Caenorhabditis elegans Hypothetical
           protein K02F3.2 protein.
          Length = 707

 Score = 43.2 bits (97), Expect = 2e-04
 Identities = 21/56 (37%), Positives = 30/56 (53%)
 Frame = +3

Query: 87  FLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGL 254
           FL G ++ A   TAV PI+ VK  +Q Q  S     +  YK  +D F ++ K +GL
Sbjct: 373 FLLGSVAGACGATAVYPIDLVKTRMQNQRTSGSFVGEVMYKNSLDCFKKVVKFEGL 428



 Score = 29.1 bits (62), Expect = 3.3
 Identities = 10/18 (55%), Positives = 14/18 (77%)
 Frame = +1

Query: 526 NCISKIFKSDGLIGLYRG 579
           +C  K+ K +GL+GLYRG
Sbjct: 417 DCFKKVVKFEGLLGLYRG 434


>Z50873-3|CAA90761.4|  531|Caenorhabditis elegans Hypothetical
           protein F17E5.2 protein.
          Length = 531

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 28/85 (32%), Positives = 38/85 (44%), Gaps = 3/85 (3%)
 Frame = +2

Query: 233 HPQGAGSLSFWRGNFANVIRYFPTQALNFAFKDKYK---QVFLGGVDKKTQFWRYFXXXX 403
           H +G G  SFWRGN  NVI+  P  A+ F   D+ K   Q + GG +  T          
Sbjct: 292 HAEG-GIKSFWRGNGINVIKIAPESAMKFMCYDQIKRWMQEYKGGAELST------IERL 344

Query: 404 XXXXXXXXTSLCFVYPLDFARTRLA 478
                    S   +YP++  +TRLA
Sbjct: 345 LAGSSAGAISQTAIYPMEVMKTRLA 369



 Score = 35.1 bits (77), Expect = 0.051
 Identities = 13/29 (44%), Positives = 22/29 (75%)
 Frame = +3

Query: 81  KDFLAGGISAAVSKTAVAPIERVKLLLQV 167
           +  +AGG++ A+S+T  AP +R+K+ LQV
Sbjct: 246 RHLVAGGVAGAMSRTCTAPFDRIKVYLQV 274


>Z75532-5|CAD56651.1|  360|Caenorhabditis elegans Hypothetical
           protein C54G10.4b protein.
          Length = 360

 Score = 36.7 bits (81), Expect = 0.017
 Identities = 20/66 (30%), Positives = 32/66 (48%)
 Frame = +3

Query: 57  LADPVAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRI 236
           + DP +    F+ G  +        AP ER+KLLLQ+Q       A  ++ G +DA  ++
Sbjct: 89  MEDPDSITSHFVGGCAAGMAQSVIAAPTERIKLLLQIQ----DDKAHTKFNGPIDATKQL 144

Query: 237 PKEQGL 254
            +  GL
Sbjct: 145 LRTHGL 150


>Z75532-4|CAA99811.1|  310|Caenorhabditis elegans Hypothetical
           protein C54G10.4a protein.
          Length = 310

 Score = 36.7 bits (81), Expect = 0.017
 Identities = 20/66 (30%), Positives = 32/66 (48%)
 Frame = +3

Query: 57  LADPVAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRI 236
           + DP +    F+ G  +        AP ER+KLLLQ+Q       A  ++ G +DA  ++
Sbjct: 89  MEDPDSITSHFVGGCAAGMAQSVIAAPTERIKLLLQIQ----DDKAHTKFNGPIDATKQL 144

Query: 237 PKEQGL 254
            +  GL
Sbjct: 145 LRTHGL 150


>AF003384-5|AAB54239.2|  324|Caenorhabditis elegans Uncoupling
           protein (mitochondrialsubstrate carrier) protein 4
           protein.
          Length = 324

 Score = 36.7 bits (81), Expect = 0.017
 Identities = 17/59 (28%), Positives = 30/59 (50%)
 Frame = +3

Query: 81  KDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLF 257
           K  L G  S  +++ A +P + VK+ +Q++ + +      RY G  D F  + + QG F
Sbjct: 121 KSMLCGAFSGLIAQFAASPTDLVKVQMQMEGLRRLQKQPLRYTGATDCFRSLYRTQGFF 179



 Score = 29.1 bits (62), Expect = 3.3
 Identities = 19/68 (27%), Positives = 33/68 (48%), Gaps = 1/68 (1%)
 Frame = +3

Query: 57  LADPVAFAKDFLAGGISAAVSKTA-VAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVR 233
           L   VA A   LA  I +  S       +++++  L  + + K+      YKG+VD +++
Sbjct: 221 LTHAVASACAGLAAAIVSLPSDVVKTRMMDQIRHELDAKMMHKKNTHVDLYKGVVDCYIK 280

Query: 234 IPKEQGLF 257
           I K +G F
Sbjct: 281 IIKNEGFF 288


>Z78542-7|CAB01750.1|  300|Caenorhabditis elegans Hypothetical
           protein F20D1.9 protein.
          Length = 300

 Score = 35.5 bits (78), Expect = 0.038
 Identities = 24/59 (40%), Positives = 32/59 (54%)
 Frame = +3

Query: 75  FAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQG 251
           F   FLAG  S A S   V P++ +K  +Q   ++K  A +  YK I DAFV I K +G
Sbjct: 202 FYGSFLAGLTSGAASSFCVTPLDVIKTRMQT--INKG-ANEIVYKNIPDAFVTIFKNEG 257


>Z70310-10|CAA94371.2|  341|Caenorhabditis elegans Hypothetical
           protein Y43C5B.3 protein.
          Length = 341

 Score = 33.5 bits (73), Expect = 0.16
 Identities = 14/24 (58%), Positives = 19/24 (79%), Gaps = 1/24 (4%)
 Frame = +1

Query: 514 SGLGNCISK-IFKSDGLIGLYRGF 582
           SGLG  + K I+K+DG++G YRGF
Sbjct: 190 SGLGTSVIKAIYKTDGILGFYRGF 213


>AL023841-13|CAA19513.2|  341|Caenorhabditis elegans Hypothetical
           protein Y43C5B.3 protein.
          Length = 341

 Score = 33.5 bits (73), Expect = 0.16
 Identities = 14/24 (58%), Positives = 19/24 (79%), Gaps = 1/24 (4%)
 Frame = +1

Query: 514 SGLGNCISK-IFKSDGLIGLYRGF 582
           SGLG  + K I+K+DG++G YRGF
Sbjct: 190 SGLGTSVIKAIYKTDGILGFYRGF 213


>CU457741-10|CAM36351.1|  313|Caenorhabditis elegans Hypothetical
           protein C42C1.10 protein.
          Length = 313

 Score = 33.1 bits (72), Expect = 0.21
 Identities = 16/63 (25%), Positives = 34/63 (53%)
 Frame = +3

Query: 63  DPVAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPK 242
           +P+  A+   AG  S  V++  + P++ +K+  Q+Q    +     +YKG++ +   I +
Sbjct: 11  EPLTSAEYSEAGLASGIVTRMIIQPLDVLKIRFQLQEEPIRGKKSGKYKGVMQSIFLITR 70

Query: 243 EQG 251
           E+G
Sbjct: 71  EEG 73


>Z79755-2|CAB02107.1|  294|Caenorhabditis elegans Hypothetical
           protein F43G9.3 protein.
          Length = 294

 Score = 32.7 bits (71), Expect = 0.27
 Identities = 22/78 (28%), Positives = 36/78 (46%), Gaps = 1/78 (1%)
 Frame = +2

Query: 248 GSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVF-LGGVDKKTQFWRYFXXXXXXXXXXX 424
           G  + +RGN A + R  P  ++ FA  ++YK++  +     +T   RY            
Sbjct: 67  GFFALYRGNSATMARVVPYASMQFAAFEQYKKLLKVDENGSRTPVKRYI-----TGSLAA 121

Query: 425 XTSLCFVYPLDFARTRLA 478
            T+    YPLD A+ RL+
Sbjct: 122 TTATMITYPLDTAKARLS 139


>Z49068-10|CAA88858.1|  296|Caenorhabditis elegans Hypothetical
           protein K01C8.7a protein.
          Length = 296

 Score = 32.7 bits (71), Expect = 0.27
 Identities = 11/24 (45%), Positives = 17/24 (70%)
 Frame = +1

Query: 511 FSGLGNCISKIFKSDGLIGLYRGF 582
           ++G+ +C+ K  K +G  GLYRGF
Sbjct: 146 YAGMMDCLKKTVKQEGFFGLYRGF 169



 Score = 29.1 bits (62), Expect = 3.3
 Identities = 17/68 (25%), Positives = 33/68 (48%)
 Frame = +3

Query: 54  NLADPVAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVR 233
           N +     A + ++G IS +       PI   K  L +Q+ ++Q    ++Y G++D   +
Sbjct: 99  NFSTGSKLANNLISGCISGSAIMCITNPIWLTKTRLCLQYENQQ---SKKYAGMMDCLKK 155

Query: 234 IPKEQGLF 257
             K++G F
Sbjct: 156 TVKQEGFF 163


>Z48240-1|CAA88283.1|  312|Caenorhabditis elegans DIF-1 protein.
          Length = 312

 Score = 32.3 bits (70), Expect = 0.36
 Identities = 17/62 (27%), Positives = 31/62 (50%)
 Frame = +3

Query: 69  VAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQ 248
           + F ++  AG ++   +   + P ER+K LLQVQ       +   Y G +D   ++ K+ 
Sbjct: 102 MTFIQNANAGALAGVFTTIVMVPGERIKCLLQVQQAG-SAGSGVHYDGPLDVVKKLYKQG 160

Query: 249 GL 254
           G+
Sbjct: 161 GI 162



 Score = 28.7 bits (61), Expect = 4.4
 Identities = 14/58 (24%), Positives = 28/58 (48%)
 Frame = +3

Query: 84  DFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLF 257
           +F+AGG+  + +     P + VK+ +Q   + K      ++ G +D   R   ++G F
Sbjct: 7   NFIAGGVGGSCTVIVGHPFDTVKVRIQTMPMPKP-GEKPQFTGALDCVKRTVSKEGFF 63


>X76115-1|CAA53721.1|  312|Caenorhabditis elegans carrier protein
           (c1) protein.
          Length = 312

 Score = 32.3 bits (70), Expect = 0.36
 Identities = 17/62 (27%), Positives = 31/62 (50%)
 Frame = +3

Query: 69  VAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQ 248
           + F ++  AG ++   +   + P ER+K LLQVQ       +   Y G +D   ++ K+ 
Sbjct: 102 MTFIQNANAGALAGVFTTIVMVPGERIKCLLQVQQAG-SAGSGVHYDGPLDVVKKLYKQG 160

Query: 249 GL 254
           G+
Sbjct: 161 GI 162



 Score = 28.7 bits (61), Expect = 4.4
 Identities = 14/58 (24%), Positives = 28/58 (48%)
 Frame = +3

Query: 84  DFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLF 257
           +F+AGG+  + +     P + VK+ +Q   + K      ++ G +D   R   ++G F
Sbjct: 7   NFIAGGVGGSCTVIVGHPFDTVKVRIQTMPMPKP-GEKPQFTGALDCVKRTVSKEGFF 63


>U61949-5|AAB03153.2|  312|Caenorhabditis elegans Differentiation
           abnormal protein 1 protein.
          Length = 312

 Score = 32.3 bits (70), Expect = 0.36
 Identities = 17/62 (27%), Positives = 31/62 (50%)
 Frame = +3

Query: 69  VAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQ 248
           + F ++  AG ++   +   + P ER+K LLQVQ       +   Y G +D   ++ K+ 
Sbjct: 102 MTFIQNANAGALAGVFTTIVMVPGERIKCLLQVQQAG-SAGSGVHYDGPLDVVKKLYKQG 160

Query: 249 GL 254
           G+
Sbjct: 161 GI 162



 Score = 28.7 bits (61), Expect = 4.4
 Identities = 14/58 (24%), Positives = 28/58 (48%)
 Frame = +3

Query: 84  DFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLF 257
           +F+AGG+  + +     P + VK+ +Q   + K      ++ G +D   R   ++G F
Sbjct: 7   NFIAGGVGGSCTVIVGHPFDTVKVRIQTMPMPKP-GEKPQFTGALDCVKRTVSKEGFF 63


>AF067608-15|AAO38679.1|  470|Caenorhabditis elegans Hypothetical
           protein B0511.14b protein.
          Length = 470

 Score = 30.7 bits (66), Expect = 1.1
 Identities = 23/79 (29%), Positives = 40/79 (50%), Gaps = 1/79 (1%)
 Frame = +2

Query: 152 AAAPSTARQQADRRRPALQGYRRRLRPHPQGAGSLSFWRGNFANVIRYFPTQALNFAFKD 331
           +A PS++R+Q+ RR     G   R R + + AGS + + GN    + +F  + L      
Sbjct: 373 SALPSSSRRQSRRRSST--GATNRKRKYTRRAGSPAVFAGNLMKKVHFFGLKYLQ----- 425

Query: 332 KYKQVFLG-GVDKKTQFWR 385
             K  F+   + KKT+F++
Sbjct: 426 --KLTFMSLEIKKKTKFYQ 442


>AF125451-12|AAP13764.1|  173|Caenorhabditis elegans Hypothetical
           protein Y37E11B.10c protein.
          Length = 173

 Score = 30.3 bits (65), Expect = 1.4
 Identities = 16/38 (42%), Positives = 21/38 (55%), Gaps = 1/38 (2%)
 Frame = +2

Query: 449 PLDFARTRLAADVGKGDGQRNSPVSETASARS-SSPTV 559
           P DF      +D   G G+ NS VSET +A S +SP +
Sbjct: 58  PSDFESNSGLSDTSAGSGRANSAVSETTTAMSATSPEI 95


>AF125451-11|AAP13763.1|  525|Caenorhabditis elegans Hypothetical
           protein Y37E11B.10b protein.
          Length = 525

 Score = 30.3 bits (65), Expect = 1.4
 Identities = 16/38 (42%), Positives = 21/38 (55%), Gaps = 1/38 (2%)
 Frame = +2

Query: 449 PLDFARTRLAADVGKGDGQRNSPVSETASARS-SSPTV 559
           P DF      +D   G G+ NS VSET +A S +SP +
Sbjct: 58  PSDFESNSGLSDTSAGSGRANSAVSETTTAMSATSPEI 95


>AF125451-10|AAD12819.2|  511|Caenorhabditis elegans Hypothetical
           protein Y37E11B.10a protein.
          Length = 511

 Score = 30.3 bits (65), Expect = 1.4
 Identities = 16/38 (42%), Positives = 21/38 (55%), Gaps = 1/38 (2%)
 Frame = +2

Query: 449 PLDFARTRLAADVGKGDGQRNSPVSETASARS-SSPTV 559
           P DF      +D   G G+ NS VSET +A S +SP +
Sbjct: 58  PSDFESNSGLSDTSAGSGRANSAVSETTTAMSATSPEI 95


>Z75955-5|CAB00119.2|  285|Caenorhabditis elegans Hypothetical
           protein R07B7.10 protein.
          Length = 285

 Score = 29.9 bits (64), Expect = 1.9
 Identities = 17/58 (29%), Positives = 28/58 (48%)
 Frame = +3

Query: 84  DFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLF 257
           DF+AG  +         P++ VK  LQ  ++         YKGIVD  V+  K++ ++
Sbjct: 4   DFIAGWAAGGAGLLVGHPLDTVKARLQTMNI---------YKGIVDCMVKTMKQESVY 52


>Z22180-4|CAA80178.1|  312|Caenorhabditis elegans Hypothetical
           protein K11H3.3 protein.
          Length = 312

 Score = 29.9 bits (64), Expect = 1.9
 Identities = 28/82 (34%), Positives = 39/82 (47%)
 Frame = +3

Query: 9   GHIHLVKIT*SNKMSNLADPVAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQI 188
           G    +K   +++  NL+ PV      L  G+S AV   AV P+E VK    V+ +  Q 
Sbjct: 103 GTFEYLKSQAADERGNLS-PVMRLLCGLGAGLSEAVF--AVTPMETVK----VKFIHDQG 155

Query: 189 AADQRYKGIVDAFVRIPKEQGL 254
            A  +YKG V     I K +GL
Sbjct: 156 LAQPKYKGFVHGVGCIVKAEGL 177


>Z75539-1|CAA99843.1|  672|Caenorhabditis elegans Hypothetical
           protein F28C1.1 protein.
          Length = 672

 Score = 27.9 bits (59), Expect = 7.7
 Identities = 16/40 (40%), Positives = 19/40 (47%)
 Frame = -1

Query: 461 RSRGGTRSTERWLRRHHRRPDYQRSNARTASSCQRRRGTP 342
           RSR  TR   R  R + RR    R   R + S  RRR +P
Sbjct: 418 RSRSRTRDRRRPRRSNSRRRSRSRDRQRRSRSRDRRRYSP 457


>U80836-10|AAB37890.2|  306|Caenorhabditis elegans Hypothetical
           protein B0432.4 protein.
          Length = 306

 Score = 27.9 bits (59), Expect = 7.7
 Identities = 15/63 (23%), Positives = 28/63 (44%)
 Frame = +3

Query: 66  PVAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKE 245
           P++F    + G  +  +      P E + L+         +   + Y G+V+A  RI KE
Sbjct: 102 PLSFGMKAVLGMTAGGIGSFVGTPAE-IALIRMTGDGRLPVEQRRNYTGVVNALTRITKE 160

Query: 246 QGL 254
           +G+
Sbjct: 161 EGV 163


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 14,126,975
Number of Sequences: 27780
Number of extensions: 260414
Number of successful extensions: 921
Number of sequences better than 10.0: 32
Number of HSP's better than 10.0 without gapping: 817
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 920
length of database: 12,740,198
effective HSP length: 79
effective length of database: 10,545,578
effective search space used: 1687292480
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -