SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20002
         (732 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z68314-9|CAA92667.2| 2862|Caenorhabditis elegans Hypothetical pr...    29   4.5  
Z66497-12|CAA91289.2| 2862|Caenorhabditis elegans Hypothetical p...    29   4.5  
AB223006-1|BAE16563.1| 2862|Caenorhabditis elegans Mediator comp...    29   4.5  
Z82268-2|CAD89737.1|  389|Caenorhabditis elegans Hypothetical pr...    28   7.8  
Z82268-1|CAB05197.3|  508|Caenorhabditis elegans Hypothetical pr...    28   7.8  
U80846-3|AAC70890.1| 2232|Caenorhabditis elegans Hypothetical pr...    28   7.8  
U41027-2|AAV28335.1|  447|Caenorhabditis elegans Hypothetical pr...    28   7.8  
AL132948-36|CAD57707.2|  186|Caenorhabditis elegans Hypothetical...    28   7.8  
AF324054-1|AAK01415.1|  162|Caenorhabditis elegans Ly-6-related ...    28   7.8  

>Z68314-9|CAA92667.2| 2862|Caenorhabditis elegans Hypothetical
           protein K08F8.6 protein.
          Length = 2862

 Score = 28.7 bits (61), Expect = 4.5
 Identities = 12/25 (48%), Positives = 17/25 (68%), Gaps = 1/25 (4%)
 Frame = +2

Query: 458 RIPKIA-ENNYFQTFFFPVIYLTNN 529
           +IPK+  ++NY    F P+ YLTNN
Sbjct: 691 KIPKVPNDDNYKPKSFLPITYLTNN 715


>Z66497-12|CAA91289.2| 2862|Caenorhabditis elegans Hypothetical
           protein K08F8.6 protein.
          Length = 2862

 Score = 28.7 bits (61), Expect = 4.5
 Identities = 12/25 (48%), Positives = 17/25 (68%), Gaps = 1/25 (4%)
 Frame = +2

Query: 458 RIPKIA-ENNYFQTFFFPVIYLTNN 529
           +IPK+  ++NY    F P+ YLTNN
Sbjct: 691 KIPKVPNDDNYKPKSFLPITYLTNN 715


>AB223006-1|BAE16563.1| 2862|Caenorhabditis elegans Mediator complex
           subunit Med13 protein.
          Length = 2862

 Score = 28.7 bits (61), Expect = 4.5
 Identities = 12/25 (48%), Positives = 17/25 (68%), Gaps = 1/25 (4%)
 Frame = +2

Query: 458 RIPKIA-ENNYFQTFFFPVIYLTNN 529
           +IPK+  ++NY    F P+ YLTNN
Sbjct: 691 KIPKVPNDDNYKPKSFLPITYLTNN 715


>Z82268-2|CAD89737.1|  389|Caenorhabditis elegans Hypothetical
           protein F52B11.1b protein.
          Length = 389

 Score = 27.9 bits (59), Expect = 7.8
 Identities = 17/56 (30%), Positives = 26/56 (46%), Gaps = 3/56 (5%)
 Frame = +3

Query: 174 KKNSIPLCR---TNTNTTLKILRRHCTSARRIGDAEGKVVGGYRVLLPDGRLMTVE 332
           K N +  C    + TN+  K L+  C   R++GD +   V GY     DG + T +
Sbjct: 188 KNNDMFYCEKYDSRTNSFCKRLKSLCPEHRKLGDEQHLKVCGYPKKWEDGMIETAK 243


>Z82268-1|CAB05197.3|  508|Caenorhabditis elegans Hypothetical
           protein F52B11.1a protein.
          Length = 508

 Score = 27.9 bits (59), Expect = 7.8
 Identities = 17/56 (30%), Positives = 26/56 (46%), Gaps = 3/56 (5%)
 Frame = +3

Query: 174 KKNSIPLCR---TNTNTTLKILRRHCTSARRIGDAEGKVVGGYRVLLPDGRLMTVE 332
           K N +  C    + TN+  K L+  C   R++GD +   V GY     DG + T +
Sbjct: 307 KNNDMFYCEKYDSRTNSFCKRLKSLCPEHRKLGDEQHLKVCGYPKKWEDGMIETAK 362


>U80846-3|AAC70890.1| 2232|Caenorhabditis elegans Hypothetical protein
            K06A9.1b protein.
          Length = 2232

 Score = 27.9 bits (59), Expect = 7.8
 Identities = 13/35 (37%), Positives = 20/35 (57%)
 Frame = -3

Query: 364  GTKPLSPCTVYSTVMSLPSGRSTRYPPTTLPSASP 260
            GT P SP ++    ++    +ST    T+LPS+SP
Sbjct: 1963 GTNPSSPRSLSQITITPSPSQSTESTQTSLPSSSP 1997


>U41027-2|AAV28335.1|  447|Caenorhabditis elegans Hypothetical
           protein R08E3.4a protein.
          Length = 447

 Score = 27.9 bits (59), Expect = 7.8
 Identities = 10/38 (26%), Positives = 20/38 (52%)
 Frame = -2

Query: 317 STVRKKHSVPPNDFAFSVTDSSRRSTMSSQDLQRRICI 204
           S   + HS P N+ + S+T+  +  T   +D +  +C+
Sbjct: 386 SPSEQSHSPPANESSLSLTEKEKSPTPEKEDEENVVCV 423


>AL132948-36|CAD57707.2|  186|Caenorhabditis elegans Hypothetical
           protein Y39B6A.48 protein.
          Length = 186

 Score = 27.9 bits (59), Expect = 7.8
 Identities = 14/58 (24%), Positives = 27/58 (46%)
 Frame = +1

Query: 295 ECFFLTVDS*RSSTQYKATVALYPKSVSIVTLTPSVKESKVSARCFPACLCVLFPNTE 468
           EC+     S ++S +Y  T  +YPK  +     P+ +    +  C   C+ ++ P+ E
Sbjct: 47  ECYSCMSLSYQTSWKYLQTTYIYPKVFTDRCRDPNSERGMPTVMCGSVCVSLMEPDVE 104


>AF324054-1|AAK01415.1|  162|Caenorhabditis elegans Ly-6-related
           protein HOT-2 protein.
          Length = 162

 Score = 27.9 bits (59), Expect = 7.8
 Identities = 14/58 (24%), Positives = 27/58 (46%)
 Frame = +1

Query: 295 ECFFLTVDS*RSSTQYKATVALYPKSVSIVTLTPSVKESKVSARCFPACLCVLFPNTE 468
           EC+     S ++S +Y  T  +YPK  +     P+ +    +  C   C+ ++ P+ E
Sbjct: 10  ECYSCMSLSYQTSWKYLQTTYIYPKVFTDRCRDPNSERGMPTVMCGSVCVSLMEPDVE 67


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 15,427,447
Number of Sequences: 27780
Number of extensions: 310146
Number of successful extensions: 796
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 767
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 796
length of database: 12,740,198
effective HSP length: 80
effective length of database: 10,517,798
effective search space used: 1714401074
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -