SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20001
         (745 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z80223-1|CAB02319.1|  640|Caenorhabditis elegans Hypothetical pr...   204   7e-53
M18540-1|AAA28078.1|  640|Caenorhabditis elegans protein ( C.ele...   201   4e-52
Z83108-5|CAB05508.1|  645|Caenorhabditis elegans Hypothetical pr...   175   4e-44
Z83108-4|CAB05507.1|  645|Caenorhabditis elegans Hypothetical pr...   175   4e-44
AF000264-1|AAC71123.1|  657|Caenorhabditis elegans Heat shock pr...   164   7e-41
U56965-1|AAB52671.1|  661|Caenorhabditis elegans Heat shock prot...   163   1e-40
M26604-1|AAA28074.1|  661|Caenorhabditis elegans protein ( C. el...   163   1e-40
Z81467-1|CAB03871.1|  643|Caenorhabditis elegans Hypothetical pr...   118   4e-27
U88315-3|AAB42371.1|  657|Caenorhabditis elegans Heat shock prot...   118   6e-27
X07678-1|CAA30525.1|  487|Caenorhabditis elegans hsp6F protein.        86   3e-17
Z81113-10|CAB54300.1|  607|Caenorhabditis elegans Hypothetical p...    71   9e-13
Z81059-7|CAB54217.1|  607|Caenorhabditis elegans Hypothetical pr...    71   9e-13
L09634-1|AAA27967.1|  776|Caenorhabditis elegans Hypothetical pr...    62   3e-10
Z49967-2|CAA90248.2|  450|Caenorhabditis elegans Hypothetical pr...    56   2e-08
U28940-6|AAA68352.1|  925|Caenorhabditis elegans Hypothetical pr...    48   5e-06
Z67884-4|CAH60753.1|  905|Caenorhabditis elegans Hypothetical pr...    47   2e-05
Z67884-3|CAA91809.2|  921|Caenorhabditis elegans Hypothetical pr...    47   2e-05
U41748-3|AAA83336.1|  452|Caenorhabditis elegans Dumpy : shorter...    31   1.1  
Z70284-14|CAA94285.4|  422|Caenorhabditis elegans Hypothetical p...    30   1.5  
AF022979-6|ABD94088.1|   94|Caenorhabditis elegans Hypothetical ...    30   1.5  
U41105-8|AAA82403.1|  460|Caenorhabditis elegans Hypothetical pr...    29   2.6  
Z81136-5|CAB03460.2|  733|Caenorhabditis elegans Hypothetical pr...    29   4.6  
AF039044-13|AAG24128.2|  435|Caenorhabditis elegans Hypothetical...    29   4.6  
AL117204-6|CAB55149.2|  833|Caenorhabditis elegans Hypothetical ...    28   6.1  
U41105-4|AAA82397.2|  407|Caenorhabditis elegans 3-ketoacyl-coa ...    28   8.0  

>Z80223-1|CAB02319.1|  640|Caenorhabditis elegans Hypothetical
           protein F26D10.3 protein.
          Length = 640

 Score =  204 bits (497), Expect = 7e-53
 Identities = 115/201 (57%), Positives = 128/201 (63%), Gaps = 2/201 (0%)
 Frame = +3

Query: 72  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 251
           M+K  AVGIDLGTTYSCVGVF HGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
Sbjct: 1   MSKHNAVGIDLGTTYSCVGVFMHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 60

Query: 252 MTP-TTQYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKPFSPRKS 428
           M P  T +    +         +           +S   A  + +   + + K F+P + 
Sbjct: 61  MNPHNTVFDAKRLIGRKFDDPAVQSDMKHWPFKVISAEGAKPKVQVEYKGENKIFTPEEI 120

Query: 429 VPWCXXXXXXXXXXILANCA-ECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAA 605
                          L     +      AYFNDSQRQATKDAG I+GLNVLRIINEPTAA
Sbjct: 121 SSMVLLKMKETAEAFLGTTVKDAVVTVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAA 180

Query: 606 AIAYGLDKKGTGERNVLIFDL 668
           AIAYGLDKKG GERNVLIFDL
Sbjct: 181 AIAYGLDKKGHGERNVLIFDL 201



 Score =  151 bits (367), Expect = 4e-37
 Identities = 89/169 (52%), Positives = 108/169 (63%), Gaps = 5/169 (2%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVS-DGGKPKIKVAYKGEDKTFFPEEVS 430
           +P+NT+FDAKRLIGRKF+D  VQ+DMKHWPF+V+S +G KPK++V YKGE+K F PEE+S
Sbjct: 62  NPHNTVFDAKRLIGRKFDDPAVQSDMKHWPFKVISAEGAKPKVQVEYKGENKIFTPEEIS 121

Query: 431 SMVLTKMKETAEAYLGKLCRMQL----SRFRVLQ*LSKTSHKRCRYHLWLERSPNHQ*TD 598
           SMVL KMKETAEA+LG   +  +    + F   Q    T        L + R  N     
Sbjct: 122 SMVLLKMKETAEAFLGTTVKDAVVTVPAYFNDSQ-RQATKDAGAIAGLNVLRIINEPTAA 180

Query: 599 CCCDCLRS*QKGYWRTKCTYL*PRGGTFDVSILTIEDGIFEVKSTAGDT 745
                L   +KG+           GGTFDVSILTIEDGIFEVKSTAGDT
Sbjct: 181 AIAYGLD--KKGHGERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDT 227


>M18540-1|AAA28078.1|  640|Caenorhabditis elegans protein (
           C.elegans heat shockprotein 70A gene, complete cds. ).
          Length = 640

 Score =  201 bits (491), Expect = 4e-52
 Identities = 114/201 (56%), Positives = 127/201 (63%), Gaps = 2/201 (0%)
 Frame = +3

Query: 72  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 251
           M+K  AVGIDLGTTYSCVGVF HGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
Sbjct: 1   MSKHNAVGIDLGTTYSCVGVFMHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 60

Query: 252 MTP-TTQYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKPFSPRKS 428
           M P  T +    +         +           +S   A  + +   + + K F+P + 
Sbjct: 61  MNPHNTVFDAKRLIGRKFDDPAVQSDMKHWPFKVISAEGAKPKVQVEYKGENKIFTPEEI 120

Query: 429 VPWCXXXXXXXXXXIL-ANCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAA 605
                          L     +       YFNDSQRQATKDAG I+GLNVLRIINEPTAA
Sbjct: 121 SSMVLLKMKKTAEAFLEPTVKDAVVTVPTYFNDSQRQATKDAGAIAGLNVLRIINEPTAA 180

Query: 606 AIAYGLDKKGTGERNVLIFDL 668
           AIAYGLDKKG GERNVLIFDL
Sbjct: 181 AIAYGLDKKGHGERNVLIFDL 201



 Score =  146 bits (355), Expect = 1e-35
 Identities = 87/169 (51%), Positives = 107/169 (63%), Gaps = 5/169 (2%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVS-DGGKPKIKVAYKGEDKTFFPEEVS 430
           +P+NT+FDAKRLIGRKF+D  VQ+DMKHWPF+V+S +G KPK++V YKGE+K F PEE+S
Sbjct: 62  NPHNTVFDAKRLIGRKFDDPAVQSDMKHWPFKVISAEGAKPKVQVEYKGENKIFTPEEIS 121

Query: 431 SMVLTKMKETAEAYLGKLCRMQL----SRFRVLQ*LSKTSHKRCRYHLWLERSPNHQ*TD 598
           SMVL KMK+TAEA+L    +  +    + F   Q    T        L + R  N     
Sbjct: 122 SMVLLKMKKTAEAFLEPTVKDAVVTVPTYFNDSQ-RQATKDAGAIAGLNVLRIINEPTAA 180

Query: 599 CCCDCLRS*QKGYWRTKCTYL*PRGGTFDVSILTIEDGIFEVKSTAGDT 745
                L   +KG+           GGTFDVSILTIEDGIFEVKSTAGDT
Sbjct: 181 AIAYGLD--KKGHGERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDT 227


>Z83108-5|CAB05508.1|  645|Caenorhabditis elegans Hypothetical
           protein F44E5.5 protein.
          Length = 645

 Score =  175 bits (425), Expect = 4e-44
 Identities = 101/206 (49%), Positives = 127/206 (61%), Gaps = 7/206 (3%)
 Frame = +3

Query: 72  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 251
           M+   A+GIDLGTTYSCVG++Q+GKVEI+AN +GN+TTPSYVAFTDTERL+GDAAK+Q A
Sbjct: 1   MSSCKAIGIDLGTTYSCVGIYQNGKVEILANSEGNKTTPSYVAFTDTERLVGDAAKDQAA 60

Query: 252 MTP-TTQYSMPNVSS---DVSSKMLLCK--PT*STGLSRLSVMEANLRSR*HIRVKTKPF 413
             P  T +    +     D S+    CK  P    G     V+E  ++       + + F
Sbjct: 61  RNPENTVFDAKRLIGRRFDESTVQSDCKHWPFGVKGKQGKPVIEVEVKG------EKRQF 114

Query: 414 SPRKSVPWCXXXXXXXXXXILANCA-ECSYHGSAYFNDSQRQATKDAGTISGLNVLRIIN 590
           +P +                L +   +      AYFNDSQRQATKDA TI+GLN +RIIN
Sbjct: 115 NPEEISAMVLQKMKETAETYLGHTVKDAVITVPAYFNDSQRQATKDAATIAGLNAIRIIN 174

Query: 591 EPTAAAIAYGLDKKGTGERNVLIFDL 668
           EPTAAA+AYGLDK    E+NVLIFDL
Sbjct: 175 EPTAAALAYGLDKGIQDEKNVLIFDL 200



 Score =  122 bits (295), Expect = 2e-28
 Identities = 81/170 (47%), Positives = 98/170 (57%), Gaps = 6/170 (3%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT+FDAKRLIGR+F+++TVQ+D KHWPF V    GKP I+V  KGE + F PEE+S+
Sbjct: 62  NPENTVFDAKRLIGRRFDESTVQSDCKHWPFGVKGKQGKPVIEVEVKGEKRQFNPEEISA 121

Query: 434 MVLTKMKETAEAYLGKLCRMQL----SRFRVLQ*LSKTSHKRCRYHLWLERSPNHQ*TDC 601
           MVL KMKETAE YLG   +  +    + F   Q    T        L   R  N      
Sbjct: 122 MVLQKMKETAETYLGHTVKDAVITVPAYFNDSQ-RQATKDAATIAGLNAIRIINEPTAAA 180

Query: 602 CCDCLRS*QKGYWRTKCTYL*PRGG-TFDVSILTIEDG-IFEVKSTAGDT 745
               L    KG    K   +   GG TFDVSIL+I +G IFEVKSTAGDT
Sbjct: 181 LAYGL---DKGIQDEKNVLIFDLGGGTFDVSILSIAEGSIFEVKSTAGDT 227


>Z83108-4|CAB05507.1|  645|Caenorhabditis elegans Hypothetical
           protein F44E5.4 protein.
          Length = 645

 Score =  175 bits (425), Expect = 4e-44
 Identities = 101/206 (49%), Positives = 127/206 (61%), Gaps = 7/206 (3%)
 Frame = +3

Query: 72  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 251
           M+   A+GIDLGTTYSCVG++Q+GKVEI+AN +GN+TTPSYVAFTDTERL+GDAAK+Q A
Sbjct: 1   MSSCKAIGIDLGTTYSCVGIYQNGKVEILANSEGNKTTPSYVAFTDTERLVGDAAKDQAA 60

Query: 252 MTP-TTQYSMPNVSS---DVSSKMLLCK--PT*STGLSRLSVMEANLRSR*HIRVKTKPF 413
             P  T +    +     D S+    CK  P    G     V+E  ++       + + F
Sbjct: 61  RNPENTVFDAKRLIGRRFDESTVQSDCKHWPFGVKGKQGKPVIEVEVKG------EKRQF 114

Query: 414 SPRKSVPWCXXXXXXXXXXILANCA-ECSYHGSAYFNDSQRQATKDAGTISGLNVLRIIN 590
           +P +                L +   +      AYFNDSQRQATKDA TI+GLN +RIIN
Sbjct: 115 NPEEISAMVLQKMKETAETYLGHTVKDAVITVPAYFNDSQRQATKDAATIAGLNAIRIIN 174

Query: 591 EPTAAAIAYGLDKKGTGERNVLIFDL 668
           EPTAAA+AYGLDK    E+NVLIFDL
Sbjct: 175 EPTAAALAYGLDKGIQDEKNVLIFDL 200



 Score =  122 bits (295), Expect = 2e-28
 Identities = 81/170 (47%), Positives = 98/170 (57%), Gaps = 6/170 (3%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT+FDAKRLIGR+F+++TVQ+D KHWPF V    GKP I+V  KGE + F PEE+S+
Sbjct: 62  NPENTVFDAKRLIGRRFDESTVQSDCKHWPFGVKGKQGKPVIEVEVKGEKRQFNPEEISA 121

Query: 434 MVLTKMKETAEAYLGKLCRMQL----SRFRVLQ*LSKTSHKRCRYHLWLERSPNHQ*TDC 601
           MVL KMKETAE YLG   +  +    + F   Q    T        L   R  N      
Sbjct: 122 MVLQKMKETAETYLGHTVKDAVITVPAYFNDSQ-RQATKDAATIAGLNAIRIINEPTAAA 180

Query: 602 CCDCLRS*QKGYWRTKCTYL*PRGG-TFDVSILTIEDG-IFEVKSTAGDT 745
               L    KG    K   +   GG TFDVSIL+I +G IFEVKSTAGDT
Sbjct: 181 LAYGL---DKGIQDEKNVLIFDLGGGTFDVSILSIAEGSIFEVKSTAGDT 227


>AF000264-1|AAC71123.1|  657|Caenorhabditis elegans Heat shock
           protein protein 4 protein.
          Length = 657

 Score =  164 bits (398), Expect = 7e-41
 Identities = 96/199 (48%), Positives = 127/199 (63%), Gaps = 6/199 (3%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT--DTERLIGDAAKNQVAMTP- 260
           +GIDLGTTYSCVGVF++G+VEIIANDQGNR TPSYVAF+    ERLIGDAAKNQ+ + P 
Sbjct: 33  IGIDLGTTYSCVGVFKNGRVEIIANDQGNRITPSYVAFSGDQGERLIGDAAKNQLTINPE 92

Query: 261 TTQYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRV--KTKPFSPRKSVP 434
            T +    +     ++  + +           +++ + +    ++V  +TK F+P +   
Sbjct: 93  NTIFDAKRLIGRFYNEKTVQQ---DIKHWPFKIVDKSNKPNVEVKVGSETKQFTPEEVSA 149

Query: 435 WCXXXXXXXXXXILAN-CAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAI 611
                        L +          AYFND+Q+QATKDAG+I+GLNV+RIINEPTAAAI
Sbjct: 150 MVLTKMKQIAESYLGHEVKNAVVTVPAYFNDAQKQATKDAGSIAGLNVVRIINEPTAAAI 209

Query: 612 AYGLDKKGTGERNVLIFDL 668
           AYGLDKK  GERN+L+FDL
Sbjct: 210 AYGLDKK-DGERNILVFDL 227



 Score =  103 bits (248), Expect = 1e-22
 Identities = 46/75 (61%), Positives = 57/75 (76%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NTIFDAKRLIGR + + TVQ D+KHWPF++V    KP ++V    E K F PEEVS+
Sbjct: 90  NPENTIFDAKRLIGRFYNEKTVQQDIKHWPFKIVDKSNKPNVEVKVGSETKQFTPEEVSA 149

Query: 434 MVLTKMKETAEAYLG 478
           MVLTKMK+ AE+YLG
Sbjct: 150 MVLTKMKQIAESYLG 164



 Score = 43.2 bits (97), Expect = 2e-04
 Identities = 18/25 (72%), Positives = 22/25 (88%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGTFDVS+LTI+ G+FEV +T GDT
Sbjct: 229 GGTFDVSLLTIDSGVFEVLATNGDT 253


>U56965-1|AAB52671.1|  661|Caenorhabditis elegans Heat shock protein
           protein 3 protein.
          Length = 661

 Score =  163 bits (396), Expect = 1e-40
 Identities = 98/200 (49%), Positives = 125/200 (62%), Gaps = 7/200 (3%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTE--RLIGDAAKNQVAMTP- 260
           +GIDLGTTYSCVGV+++G+VEIIANDQGNR TPSYVAF+  +  RLIGDAAKNQ+ + P 
Sbjct: 36  IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFSGDQGDRLIGDAAKNQLTINPE 95

Query: 261 TTQYSMPN-VSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKT--KPFSPRKSV 431
            T +     +  D + K +              V++ + +    ++V +  K F+P +  
Sbjct: 96  NTIFDAKRLIGRDYNDKTVQA----DIKHWPFKVIDKSNKPSVEVKVGSDNKQFTPEEVS 151

Query: 432 PWCXXXXXXXXXXILAN-CAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAAA 608
                         L            AYFND+QRQATKDAGTI+GLNV+RIINEPTAAA
Sbjct: 152 AMVLVKMKEIAESYLGKEVKNAVVTVPAYFNDAQRQATKDAGTIAGLNVVRIINEPTAAA 211

Query: 609 IAYGLDKKGTGERNVLIFDL 668
           IAYGLDKK  GERN+L+FDL
Sbjct: 212 IAYGLDKK-DGERNILVFDL 230



 Score =  109 bits (261), Expect = 3e-24
 Identities = 48/76 (63%), Positives = 59/76 (77%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NTIFDAKRLIGR + D TVQAD+KHWPF+V+    KP ++V    ++K F PEEVS+
Sbjct: 93  NPENTIFDAKRLIGRDYNDKTVQADIKHWPFKVIDKSNKPSVEVKVGSDNKQFTPEEVSA 152

Query: 434 MVLTKMKETAEAYLGK 481
           MVL KMKE AE+YLGK
Sbjct: 153 MVLVKMKEIAESYLGK 168



 Score = 43.2 bits (97), Expect = 2e-04
 Identities = 18/25 (72%), Positives = 23/25 (92%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGTFDVS+LTI++G+FEV +T GDT
Sbjct: 232 GGTFDVSMLTIDNGVFEVLATNGDT 256


>M26604-1|AAA28074.1|  661|Caenorhabditis elegans protein ( C.
           elegans BiP (hsp3)gene, complete cds. ).
          Length = 661

 Score =  163 bits (396), Expect = 1e-40
 Identities = 98/200 (49%), Positives = 125/200 (62%), Gaps = 7/200 (3%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTE--RLIGDAAKNQVAMTP- 260
           +GIDLGTTYSCVGV+++G+VEIIANDQGNR TPSYVAF+  +  RLIGDAAKNQ+ + P 
Sbjct: 36  IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFSGDQGDRLIGDAAKNQLTINPE 95

Query: 261 TTQYSMPN-VSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKT--KPFSPRKSV 431
            T +     +  D + K +              V++ + +    ++V +  K F+P +  
Sbjct: 96  NTIFDAKRLIGRDYNDKTVQA----DIKHWPFKVIDKSNKPSVEVKVGSDNKQFTPEEVS 151

Query: 432 PWCXXXXXXXXXXILAN-CAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAAA 608
                         L            AYFND+QRQATKDAGTI+GLNV+RIINEPTAAA
Sbjct: 152 AMVLVKMKEIAESYLGKEVKNAVVTVPAYFNDAQRQATKDAGTIAGLNVVRIINEPTAAA 211

Query: 609 IAYGLDKKGTGERNVLIFDL 668
           IAYGLDKK  GERN+L+FDL
Sbjct: 212 IAYGLDKK-DGERNILVFDL 230



 Score =  109 bits (261), Expect = 3e-24
 Identities = 48/76 (63%), Positives = 59/76 (77%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NTIFDAKRLIGR + D TVQAD+KHWPF+V+    KP ++V    ++K F PEEVS+
Sbjct: 93  NPENTIFDAKRLIGRDYNDKTVQADIKHWPFKVIDKSNKPSVEVKVGSDNKQFTPEEVSA 152

Query: 434 MVLTKMKETAEAYLGK 481
           MVL KMKE AE+YLGK
Sbjct: 153 MVLVKMKEIAESYLGK 168



 Score = 43.2 bits (97), Expect = 2e-04
 Identities = 18/25 (72%), Positives = 23/25 (92%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGTFDVS+LTI++G+FEV +T GDT
Sbjct: 232 GGTFDVSMLTIDNGVFEVLATNGDT 256


>Z81467-1|CAB03871.1|  643|Caenorhabditis elegans Hypothetical
           protein C12C8.1 protein.
          Length = 643

 Score =  118 bits (284), Expect = 4e-27
 Identities = 80/170 (47%), Positives = 97/170 (57%), Gaps = 6/170 (3%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT+FDAKRLIGR+F++ TVQ+D+KHWPF V    GKP ++V  KGE + F  EE+S+
Sbjct: 62  NPENTVFDAKRLIGRRFDEETVQSDIKHWPFTVKGKQGKPVVEVEVKGEKREFNAEEISA 121

Query: 434 MVLTKMKETAEAYLGKLCRMQL----SRFRVLQ*LSKTSHKRCRYHLWLERSPNHQ*TDC 601
           MVL KMKETAEA LG   R  +    + F   Q    T        L   R  N      
Sbjct: 122 MVLQKMKETAEAVLGHSVRDAVITVPAYFNDSQ-RQATKDAATIAGLNAIRIINEPTAAA 180

Query: 602 CCDCLRS*QKGYWRTKCTYL*PRGG-TFDVSILTIEDG-IFEVKSTAGDT 745
               L    KG    K   +   GG TFDVSIL+I +G IFEVKSTAGDT
Sbjct: 181 LAYGL---DKGITDEKNILIFDLGGGTFDVSILSIAEGSIFEVKSTAGDT 227



 Score =  107 bits (257), Expect = 8e-24
 Identities = 46/63 (73%), Positives = 56/63 (88%)
 Frame = +3

Query: 72  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 251
           M+   A+GIDLGTTYSCVG++Q+GKVEI+AN +GN+TTPSYVAFTDTERL+GDAAK+Q A
Sbjct: 1   MSTCKAIGIDLGTTYSCVGIYQNGKVEILANSEGNKTTPSYVAFTDTERLVGDAAKDQAA 60

Query: 252 MTP 260
             P
Sbjct: 61  RNP 63



 Score = 92.7 bits (220), Expect = 2e-19
 Identities = 43/53 (81%), Positives = 48/53 (90%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDL 668
           AYFNDSQRQATKDA TI+GLN +RIINEPTAAA+AYGLDK  T E+N+LIFDL
Sbjct: 148 AYFNDSQRQATKDAATIAGLNAIRIINEPTAAALAYGLDKGITDEKNILIFDL 200


>U88315-3|AAB42371.1|  657|Caenorhabditis elegans Heat shock protein
           protein 6 protein.
          Length = 657

 Score =  118 bits (283), Expect = 6e-27
 Identities = 79/200 (39%), Positives = 109/200 (54%), Gaps = 3/200 (1%)
 Frame = +3

Query: 78  KAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQ-VA 251
           K   +GIDLGTT SCV + +    ++I N +G RTTPS VAFT D ERL+G  AK Q V 
Sbjct: 30  KGHVIGIDLGTTNSCVSIMEGKTPKVIENAEGVRTTPSTVAFTADGERLVGAPAKRQAVT 89

Query: 252 MTPTTQYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKPFSPRKSV 431
            +  T ++   +         + K      +    +++A+      +  + K +SP +  
Sbjct: 90  NSANTLFATKRLIGRRYEDPEVQK---DLKVVPYKIVKASNGDA-WVEAQGKVYSPSQVG 145

Query: 432 PWCXXXXXXXXXXILANCAECSYHG-SAYFNDSQRQATKDAGTISGLNVLRIINEPTAAA 608
            +            L      +     AYFNDSQRQATKDAG ISGLNVLR+INEPTAAA
Sbjct: 146 AFVLMKMKETAESYLGTTVNNAVVTVPAYFNDSQRQATKDAGQISGLNVLRVINEPTAAA 205

Query: 609 IAYGLDKKGTGERNVLIFDL 668
           +AYGLD K  G++ + ++DL
Sbjct: 206 LAYGLD-KDAGDKIIAVYDL 224



 Score = 64.9 bits (151), Expect = 6e-11
 Identities = 33/73 (45%), Positives = 48/73 (65%), Gaps = 1/73 (1%)
 Frame = +2

Query: 263 NTIFDAKRLIGRKFEDATVQADMKHWPFEVV-SDGGKPKIKVAYKGEDKTFFPEEVSSMV 439
           NT+F  KRLIGR++ED  VQ D+K  P+++V +  G   +    + + K + P +V + V
Sbjct: 93  NTLFATKRLIGRRYEDPEVQKDLKVVPYKIVKASNGDAWV----EAQGKVYSPSQVGAFV 148

Query: 440 LTKMKETAEAYLG 478
           L KMKETAE+YLG
Sbjct: 149 LMKMKETAESYLG 161



 Score = 45.2 bits (102), Expect = 5e-05
 Identities = 20/25 (80%), Positives = 22/25 (88%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGTFDVSIL I+ G+FEVKST GDT
Sbjct: 226 GGTFDVSILEIQKGVFEVKSTNGDT 250


>X07678-1|CAA30525.1|  487|Caenorhabditis elegans hsp6F protein.
          Length = 487

 Score = 85.8 bits (203), Expect = 3e-17
 Identities = 40/53 (75%), Positives = 47/53 (88%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDL 668
           AYFNDSQRQATKDAG ISGLNVLR+INEPTAAA+AYGLD K  G++ + ++DL
Sbjct: 173 AYFNDSQRQATKDAGQISGLNVLRVINEPTAAALAYGLD-KDAGDKIIAVYDL 224



 Score = 63.7 bits (148), Expect = 1e-10
 Identities = 33/73 (45%), Positives = 48/73 (65%), Gaps = 1/73 (1%)
 Frame = +2

Query: 263 NTIFDAKRLIGRKFEDATVQADMKHWPFEVV-SDGGKPKIKVAYKGEDKTFFPEEVSSMV 439
           NT+F  KRLIGR++ED  VQ D+K  P+++V +  G   +    + + K + P +V + V
Sbjct: 93  NTLFATKRLIGRRYEDPEVQKDLKVVPYKIVKASNGDAWV----EAQGKEYPPSQVGAFV 148

Query: 440 LTKMKETAEAYLG 478
           L KMKETAE+YLG
Sbjct: 149 LMKMKETAESYLG 161



 Score = 60.9 bits (141), Expect = 9e-10
 Identities = 31/57 (54%), Positives = 38/57 (66%), Gaps = 1/57 (1%)
 Frame = +3

Query: 78  KAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQ 245
           K   +GIDLGTT SCV + +    ++I N +G RTTPS VAFT D ERL+G  AK Q
Sbjct: 30  KGHVIGIDLGTTNSCVSIMEGKTPKVIENAEGVRTTPSTVAFTADGERLVGAPAKRQ 86



 Score = 45.2 bits (102), Expect = 5e-05
 Identities = 20/25 (80%), Positives = 22/25 (88%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGTFDVSIL I+ G+FEVKST GDT
Sbjct: 226 GGTFDVSILEIQKGVFEVKSTNGDT 250


>Z81113-10|CAB54300.1|  607|Caenorhabditis elegans Hypothetical
           protein F11F1.1 protein.
          Length = 607

 Score = 70.9 bits (166), Expect = 9e-13
 Identities = 33/53 (62%), Positives = 42/53 (79%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDL 668
           AYFN +QR+AT++A  I+GL VLRI+NEPTAAAIAY L  +    RN+LI+DL
Sbjct: 145 AYFNATQRRATEEAAEIAGLKVLRILNEPTAAAIAYSLKGQRLSRRNILIYDL 197



 Score = 61.3 bits (142), Expect = 7e-10
 Identities = 28/68 (41%), Positives = 44/68 (64%), Gaps = 1/68 (1%)
 Frame = +3

Query: 87  AVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAF-TDTERLIGDAAKNQVAMTPT 263
           ++GIDLGTT+SCV  +Q+G+V I+ N+ G RTTPS +A   D + LIG  AK+ +     
Sbjct: 2   SIGIDLGTTFSCVAYYQNGQVNILENENGCRTTPSVLAVGEDGDLLIGQHAKDVIGKATN 61

Query: 264 TQYSMPNV 287
           + + +  +
Sbjct: 62  SLFDVKRI 69



 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 29/73 (39%), Positives = 44/73 (60%), Gaps = 1/73 (1%)
 Frame = +2

Query: 263 NTIFDAKRLIGRKFEDATVQADMKHWPFEV-VSDGGKPKIKVAYKGEDKTFFPEEVSSMV 439
           N++FD KR+IGR+++D  +Q DM  WPF+V   D G P +++    +   F    VSS++
Sbjct: 61  NSLFDVKRIIGRRYDDVLLQRDMPLWPFKVEKDDNGIPYLEIHKNEKPLKFSAVTVSSLI 120

Query: 440 LTKMKETAEAYLG 478
           L  +K  AE  LG
Sbjct: 121 LRCLKYNAERKLG 133


>Z81059-7|CAB54217.1|  607|Caenorhabditis elegans Hypothetical
           protein F11F1.1 protein.
          Length = 607

 Score = 70.9 bits (166), Expect = 9e-13
 Identities = 33/53 (62%), Positives = 42/53 (79%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDL 668
           AYFN +QR+AT++A  I+GL VLRI+NEPTAAAIAY L  +    RN+LI+DL
Sbjct: 145 AYFNATQRRATEEAAEIAGLKVLRILNEPTAAAIAYSLKGQRLSRRNILIYDL 197



 Score = 61.3 bits (142), Expect = 7e-10
 Identities = 28/68 (41%), Positives = 44/68 (64%), Gaps = 1/68 (1%)
 Frame = +3

Query: 87  AVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAF-TDTERLIGDAAKNQVAMTPT 263
           ++GIDLGTT+SCV  +Q+G+V I+ N+ G RTTPS +A   D + LIG  AK+ +     
Sbjct: 2   SIGIDLGTTFSCVAYYQNGQVNILENENGCRTTPSVLAVGEDGDLLIGQHAKDVIGKATN 61

Query: 264 TQYSMPNV 287
           + + +  +
Sbjct: 62  SLFDVKRI 69



 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 29/73 (39%), Positives = 44/73 (60%), Gaps = 1/73 (1%)
 Frame = +2

Query: 263 NTIFDAKRLIGRKFEDATVQADMKHWPFEV-VSDGGKPKIKVAYKGEDKTFFPEEVSSMV 439
           N++FD KR+IGR+++D  +Q DM  WPF+V   D G P +++    +   F    VSS++
Sbjct: 61  NSLFDVKRIIGRRYDDVLLQRDMPLWPFKVEKDDNGIPYLEIHKNEKPLKFSAVTVSSLI 120

Query: 440 LTKMKETAEAYLG 478
           L  +K  AE  LG
Sbjct: 121 LRCLKYNAERKLG 133


>L09634-1|AAA27967.1|  776|Caenorhabditis elegans Hypothetical
           protein C30C11.4 protein.
          Length = 776

 Score = 62.5 bits (145), Expect = 3e-10
 Identities = 56/206 (27%), Positives = 93/206 (45%), Gaps = 13/206 (6%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPTTQ 269
           +G D+G     +GV + G +E+I ND     TP+ V+F   +R +G AA+   A+T   +
Sbjct: 4   LGFDIGNLNCYIGVARQGGIEVITNDYSLHATPACVSFGPKDRSMGVAARQ--AVTTNIK 61

Query: 270 YSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*---HIRVKTKP--FSPRKSVP 434
            ++ N    +  K     P     +  +      L +      +    +P  F+P + + 
Sbjct: 62  NTVINFKHLIGRKF--SDPVAQRFIPFIPCKVVKLPNDDIGVQVSYLGEPHTFTPEQVLA 119

Query: 435 WCXXXXXXXXXXILANC---AECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAA 605
                        L++    ++C     +YF D QR+A   A   +GLN LRI+NE TA 
Sbjct: 120 ALLTKLRTIVESQLSDVKKVSDCVLAVPSYFTDVQRRAVLSAIQYAGLNSLRIVNETTAI 179

Query: 606 AIAYGLDKKGTGE-----RNVLIFDL 668
           A+AYG+ K+   E     RNV+  D+
Sbjct: 180 ALAYGIYKQDLPEEDAKSRNVVFLDI 205



 Score = 52.0 bits (119), Expect = 4e-07
 Identities = 28/72 (38%), Positives = 41/72 (56%), Gaps = 1/72 (1%)
 Frame = +2

Query: 263 NTIFDAKRLIGRKFEDATVQADMKHWPFEVVS-DGGKPKIKVAYKGEDKTFFPEEVSSMV 439
           NT+ + K LIGRKF D   Q  +   P +VV        ++V+Y GE  TF PE+V + +
Sbjct: 62  NTVINFKHLIGRKFSDPVAQRFIPFIPCKVVKLPNDDIGVQVSYLGEPHTFTPEQVLAAL 121

Query: 440 LTKMKETAEAYL 475
           LTK++   E+ L
Sbjct: 122 LTKLRTIVESQL 133


>Z49967-2|CAA90248.2|  450|Caenorhabditis elegans Hypothetical
           protein F54C9.2 protein.
          Length = 450

 Score = 56.4 bits (130), Expect = 2e-08
 Identities = 28/78 (35%), Positives = 44/78 (56%), Gaps = 3/78 (3%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFE--DATVQADMKHWPFEVVSDG-GKPKIKVAYKGEDKTFFPEE 424
           +P  TI+DAKR IGR FE  +    +D K +PF++  D  GK   ++      K  +PEE
Sbjct: 94  NPKRTIYDAKRFIGRNFEKNNKDFLSDQKRYPFKINLDSEGKAFFEIPLDSGTKNVYPEE 153

Query: 425 VSSMVLTKMKETAEAYLG 478
           + S+++  +K  A  +LG
Sbjct: 154 IGSLIIGYLKSAAAKHLG 171



 Score = 54.8 bits (126), Expect = 6e-08
 Identities = 28/53 (52%), Positives = 36/53 (67%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDL 668
           A FN+ QR  T  A  I+ + V R+I+EPTAAA+AYGL KK  G  NV++ DL
Sbjct: 183 AEFNEKQRNFTAKAAEIAEMEVRRVISEPTAAALAYGLHKK-QGVENVVVVDL 234



 Score = 44.8 bits (101), Expect = 7e-05
 Identities = 28/71 (39%), Positives = 37/71 (52%), Gaps = 5/71 (7%)
 Frame = +3

Query: 63  KYKMAKAPA--VGIDLGTTYSCVGVFQ--HGKVEIIANDQGNRTTPSYVAFTDTER-LIG 227
           KY +   P    GIDLGTTYS +G++    G+  I+ +D G ++ PS VAF      LIG
Sbjct: 25  KYGLPPPPPKIAGIDLGTTYSSIGIYHAVTGETIILPDDLGKKSVPSVVAFLPNGTVLIG 84

Query: 228 DAAKNQVAMTP 260
             A  Q    P
Sbjct: 85  TRATEQQEHNP 95


>U28940-6|AAA68352.1|  925|Caenorhabditis elegans Hypothetical
           protein T24H7.2 protein.
          Length = 925

 Score = 48.4 bits (110), Expect = 5e-06
 Identities = 24/78 (30%), Positives = 48/78 (61%), Gaps = 3/78 (3%)
 Frame = +3

Query: 513 YFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGL-DKKGTGER--NVLIFDLAAVPS 683
           YF  ++R A + A  ++GL VL++IN+ TAAA+++G+  +K  GE+   ++++D+ A  +
Sbjct: 171 YFTPAERLAVERAAQMAGLTVLQLINDGTAAALSHGIFRRKEIGEKPQRLMVYDMGAAKT 230

Query: 684 TCPSLPSRMVSSR*NPPP 737
           T   +  ++V  +    P
Sbjct: 231 TATIVEFKLVKEKYEKQP 248



 Score = 36.7 bits (81), Expect = 0.017
 Identities = 19/51 (37%), Positives = 28/51 (54%), Gaps = 1/51 (1%)
 Frame = +3

Query: 87  AVGIDLGTTYSCVGVFQHG-KVEIIANDQGNRTTPSYVAFTDTERLIGDAA 236
           A+ IDLGT +  +G+ + G  ++I  N +  R TP+ V   D  R   DAA
Sbjct: 26  AMTIDLGTQFLKIGIVKPGIPMDIALNTESRRKTPNVVMIQDGHRTFADAA 76


>Z67884-4|CAH60753.1|  905|Caenorhabditis elegans Hypothetical
           protein T14G8.3b protein.
          Length = 905

 Score = 46.8 bits (106), Expect = 2e-05
 Identities = 25/73 (34%), Positives = 48/73 (65%), Gaps = 3/73 (4%)
 Frame = +3

Query: 513 YFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGL-DKKGTGER--NVLIFDLAAVPS 683
           + N ++R+A   A  I+GLN+L+++N+ +AAA+ YG+  +K   E+  ++LI+D+ AV +
Sbjct: 155 FLNQAERRAIASAAEIAGLNLLQLLNDGSAAALNYGVFRRKEITEKPTHMLIYDMGAVKT 214

Query: 684 TCPSLPSRMVSSR 722
           T   +   + S+R
Sbjct: 215 TATIVQYVLESTR 227


>Z67884-3|CAA91809.2|  921|Caenorhabditis elegans Hypothetical
           protein T14G8.3a protein.
          Length = 921

 Score = 46.8 bits (106), Expect = 2e-05
 Identities = 25/73 (34%), Positives = 48/73 (65%), Gaps = 3/73 (4%)
 Frame = +3

Query: 513 YFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGL-DKKGTGER--NVLIFDLAAVPS 683
           + N ++R+A   A  I+GLN+L+++N+ +AAA+ YG+  +K   E+  ++LI+D+ AV +
Sbjct: 171 FLNQAERRAIASAAEIAGLNLLQLLNDGSAAALNYGVFRRKEITEKPTHMLIYDMGAVKT 230

Query: 684 TCPSLPSRMVSSR 722
           T   +   + S+R
Sbjct: 231 TATIVQYVLESTR 243


>U41748-3|AAA83336.1|  452|Caenorhabditis elegans Dumpy : shorter
           than wild-typeprotein 8 protein.
          Length = 452

 Score = 30.7 bits (66), Expect = 1.1
 Identities = 16/46 (34%), Positives = 25/46 (54%), Gaps = 3/46 (6%)
 Frame = +2

Query: 203 HRHRASHRR--CRQEPGGDDPNNTIFDAKRLIGR-KFEDATVQADM 331
           H+HR SHR     Q+  GD+ NN + DA R +   ++ D +  + M
Sbjct: 347 HQHRKSHRLRPSHQQQYGDEQNNAVADAGRSVNAPEYGDGSAPSHM 392


>Z70284-14|CAA94285.4|  422|Caenorhabditis elegans Hypothetical
           protein K07F5.14 protein.
          Length = 422

 Score = 30.3 bits (65), Expect = 1.5
 Identities = 12/32 (37%), Positives = 19/32 (59%)
 Frame = +2

Query: 233 RQEPGGDDPNNTIFDAKRLIGRKFEDATVQAD 328
           ++   GDDP+   F    +IGRK++D  V+ D
Sbjct: 278 KERKDGDDPSTGGFSFLSMIGRKYDDEAVEDD 309


>AF022979-6|ABD94088.1|   94|Caenorhabditis elegans Hypothetical
           protein T02B11.8 protein.
          Length = 94

 Score = 30.3 bits (65), Expect = 1.5
 Identities = 13/32 (40%), Positives = 16/32 (50%)
 Frame = -3

Query: 266 CCWGHRHLVLGGISDETLGVCERNIRRSGPVA 171
           CC G  H    G S  T+G C+R    S PV+
Sbjct: 58  CCPGTNHCCPPGFSCTTIGTCKRTTTLSNPVS 89


>U41105-8|AAA82403.1|  460|Caenorhabditis elegans Hypothetical
           protein T02G5.4 protein.
          Length = 460

 Score = 29.5 bits (63), Expect = 2.6
 Identities = 16/51 (31%), Positives = 27/51 (52%)
 Frame = -1

Query: 706 LDGKDGHVEGTAARSKISTFRSPVPFLSRP*AIAAAVGSLMIRRTFKPEMV 554
           L  KD  + G AAR+ I +FRS +  ++ P   + A+ + + R   KP  +
Sbjct: 97  LSNKDAFIVG-AARTPIGSFRSSLSSVTAPELASVAIKAALERGAVKPSSI 146


>Z81136-5|CAB03460.2|  733|Caenorhabditis elegans Hypothetical
           protein W02B8.4 protein.
          Length = 733

 Score = 28.7 bits (61), Expect = 4.6
 Identities = 24/86 (27%), Positives = 42/86 (48%), Gaps = 1/86 (1%)
 Frame = +2

Query: 266 TIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLT 445
           T+  AKR I R  E  T+++D    PF +++      +K A K +D+     +   ++L 
Sbjct: 205 TVRRAKRSIIRNAESYTLKSDFDKSPFSIITKHLTNSVK-ALKKKDRI---SKWQDIILR 260

Query: 446 KMKETAEAYLGK-LCRMQLSRFRVLQ 520
             KE+++    K +  +Q  R RV Q
Sbjct: 261 IQKESSQLRKRKEIENLQRKRIRVFQ 286


>AF039044-13|AAG24128.2|  435|Caenorhabditis elegans Hypothetical
           protein F48G7.12 protein.
          Length = 435

 Score = 28.7 bits (61), Expect = 4.6
 Identities = 12/54 (22%), Positives = 29/54 (53%)
 Frame = +3

Query: 165 DQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPTTQYSMPNVSSDVSSKMLLCKP 326
           D G+    ++V   D +++IG+    +  +   T+Y++    +  SS+++L +P
Sbjct: 12  DIGDGLFQTHVQLEDVQKVIGEQMNTKARLGENTKYTVIGDGNGFSSRVILVEP 65


>AL117204-6|CAB55149.2|  833|Caenorhabditis elegans Hypothetical
           protein Y116A8C.13 protein.
          Length = 833

 Score = 28.3 bits (60), Expect = 6.1
 Identities = 14/35 (40%), Positives = 18/35 (51%), Gaps = 1/35 (2%)
 Frame = +1

Query: 142 GRWRSSPTTR-ATGPLRLMLRSQTPSVSSEMPPRT 243
           G W      R ATGP +  + +Q P + S MPP T
Sbjct: 84  GSWSVEIQERIATGPPQKPISAQKPEIQSPMPPMT 118


>U41105-4|AAA82397.2|  407|Caenorhabditis elegans 3-ketoacyl-coa
           thiolase protein 1 protein.
          Length = 407

 Score = 27.9 bits (59), Expect = 8.0
 Identities = 16/56 (28%), Positives = 28/56 (50%)
 Frame = -1

Query: 706 LDGKDGHVEGTAARSKISTFRSPVPFLSRP*AIAAAVGSLMIRRTFKPEMVPASFV 539
           L  K   + G AAR+ I +FRS +  ++ P   + A+ + + R   KP  +   F+
Sbjct: 19  LSNKHAFIVG-AARTPIGSFRSSLSSVTAPELASVAIKAALERGAVKPSSIQEVFL 73


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 18,786,497
Number of Sequences: 27780
Number of extensions: 427061
Number of successful extensions: 1330
Number of sequences better than 10.0: 25
Number of HSP's better than 10.0 without gapping: 1189
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1312
length of database: 12,740,198
effective HSP length: 80
effective length of database: 10,517,798
effective search space used: 1756472266
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -