BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0108 (498 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U23484-3|AAK68298.1| 126|Caenorhabditis elegans Sr protein (spl... 84 6e-17 U23484-2|AAC46767.1| 196|Caenorhabditis elegans Sr protein (spl... 84 6e-17 Z35601-1|CAA84667.2| 320|Caenorhabditis elegans Hypothetical pr... 39 0.002 AB036738-1|BAB13470.1| 320|Caenorhabditis elegans neural RNA-bi... 39 0.002 U23484-11|AAC46764.2| 191|Caenorhabditis elegans Hypothetical p... 38 0.004 D10877-1|BAA01645.1| 346|Caenorhabditis elegans hnRNP like prot... 38 0.004 AF038613-6|ABB51186.1| 347|Caenorhabditis elegans Human hnrnp a... 38 0.004 AF038613-5|AAB92051.1| 346|Caenorhabditis elegans Human hnrnp a... 38 0.004 Z81108-4|CAB03237.1| 85|Caenorhabditis elegans Hypothetical pr... 37 0.007 Z81037-3|CAB02750.1| 205|Caenorhabditis elegans Hypothetical pr... 36 0.012 U23484-10|AAC46772.1| 197|Caenorhabditis elegans Hypothetical p... 36 0.012 AF038623-4|AAO91699.1| 177|Caenorhabditis elegans Hypothetical ... 36 0.016 Z83127-4|CAB05631.1| 872|Caenorhabditis elegans Hypothetical pr... 36 0.022 Z92826-4|CAB07322.1| 309|Caenorhabditis elegans Hypothetical pr... 34 0.066 AF047662-1|AAC04442.1| 248|Caenorhabditis elegans Suppressor pr... 33 0.087 U41531-7|AAA83161.2| 415|Caenorhabditis elegans Feminizing gene... 33 0.12 U23450-2|AAK31468.1| 302|Caenorhabditis elegans Hypothetical pr... 33 0.12 U14946-1|AAA67723.1| 415|Caenorhabditis elegans ribonucleoprote... 33 0.12 Z50044-2|CAA90354.1| 256|Caenorhabditis elegans Hypothetical pr... 33 0.15 AC084197-11|AAM44397.1| 305|Caenorhabditis elegans Homologous t... 32 0.27 AC084197-10|AAY43984.1| 308|Caenorhabditis elegans Homologous t... 32 0.27 AF038613-8|AAL02515.2| 309|Caenorhabditis elegans Human hnrnp a... 31 0.46 AF038613-7|ABB51185.1| 308|Caenorhabditis elegans Human hnrnp a... 31 0.46 Z81473-3|CAB03896.4| 514|Caenorhabditis elegans Hypothetical pr... 31 0.61 AY342388-1|AAQ19851.1| 514|Caenorhabditis elegans putative RNA-... 31 0.61 Z97628-2|CAB10726.2| 427|Caenorhabditis elegans Hypothetical pr... 30 0.81 Z81080-5|CAB03088.2| 427|Caenorhabditis elegans Hypothetical pr... 30 0.81 Z81080-2|CAD56584.1| 358|Caenorhabditis elegans Hypothetical pr... 30 0.81 Z78419-2|CAB01702.1| 154|Caenorhabditis elegans Hypothetical pr... 30 0.81 Z36238-3|CAA85276.1| 404|Caenorhabditis elegans Hypothetical pr... 29 1.9 DQ485531-1|ABF22491.1| 404|Caenorhabditis elegans RNA-binding p... 29 1.9 Z36752-6|CAA85327.1| 456|Caenorhabditis elegans Hypothetical pr... 29 2.5 U80455-1|AAB37881.1| 584|Caenorhabditis elegans Elav-type rna b... 29 2.5 U53931-1|AAA98566.1| 584|Caenorhabditis elegans elav-type ribon... 29 2.5 U28944-7|AAN63457.1| 295|Caenorhabditis elegans Hypothetical pr... 29 2.5 U28944-6|AAN63456.1| 305|Caenorhabditis elegans Hypothetical pr... 29 2.5 U28944-5|AAK68191.1| 408|Caenorhabditis elegans Hypothetical pr... 29 2.5 U28944-4|AAK68192.1| 376|Caenorhabditis elegans Hypothetical pr... 29 2.5 EF523770-1|ABS18836.1| 513|Caenorhabditis elegans ELAV-type RNA... 29 2.5 EF523769-1|ABS18835.1| 327|Caenorhabditis elegans ELAV-type RNA... 29 2.5 EF523768-1|ABS18834.1| 378|Caenorhabditis elegans ELAV-type RNA... 29 2.5 EF523767-1|ABS18833.1| 193|Caenorhabditis elegans ELAV-type RNA... 29 2.5 EF523766-1|ABS18832.1| 584|Caenorhabditis elegans ELAV-type RNA... 29 2.5 Z78536-3|CAB01717.2| 360|Caenorhabditis elegans Hypothetical pr... 27 5.7 AC024826-10|AAM97977.1| 435|Caenorhabditis elegans Hypothetical... 27 7.6 AC024826-8|AAF60795.2| 580|Caenorhabditis elegans Hypothetical ... 27 7.6 >U23484-3|AAK68298.1| 126|Caenorhabditis elegans Sr protein (splicing factor) protein4, isoform b protein. Length = 126 Score = 83.8 bits (198), Expect = 6e-17 Identities = 33/53 (62%), Positives = 46/53 (86%) Frame = +1 Query: 94 RPPPRIDGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGF 252 R P I+G+ SLK+DNL+Y+TTP DLRR FER G++GD++IPRD+Y+R+S+GF Sbjct: 10 RAAPDINGLTSLKIDNLSYQTTPNDLRRTFERYGDIGDVHIPRDKYSRQSKGF 62 Score = 34.7 bits (76), Expect = 0.038 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = +3 Query: 279 DAXEALDTMDGRMXDGRELRVQMA 350 DA ALD DG++ DGRELRV +A Sbjct: 72 DAEHALDRTDGKLVDGRELRVTLA 95 >U23484-2|AAC46767.1| 196|Caenorhabditis elegans Sr protein (splicing factor) protein4, isoform a protein. Length = 196 Score = 83.8 bits (198), Expect = 6e-17 Identities = 33/53 (62%), Positives = 46/53 (86%) Frame = +1 Query: 94 RPPPRIDGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGF 252 R P I+G+ SLK+DNL+Y+TTP DLRR FER G++GD++IPRD+Y+R+S+GF Sbjct: 10 RAAPDINGLTSLKIDNLSYQTTPNDLRRTFERYGDIGDVHIPRDKYSRQSKGF 62 Score = 34.7 bits (76), Expect = 0.038 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = +3 Query: 279 DAXEALDTMDGRMXDGRELRVQMA 350 DA ALD DG++ DGRELRV +A Sbjct: 72 DAEHALDRTDGKLVDGRELRVTLA 95 >Z35601-1|CAA84667.2| 320|Caenorhabditis elegans Hypothetical protein R10E9.1 protein. Length = 320 Score = 38.7 bits (86), Expect = 0.002 Identities = 17/40 (42%), Positives = 26/40 (65%) Frame = +1 Query: 133 VDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGF 252 + L+++TT E+LR F R GEV + + RD T+ +RGF Sbjct: 49 IGGLSWQTTAENLRDYFGRFGEVNECMVMRDPATKRARGF 88 Score = 31.5 bits (68), Expect = 0.35 Identities = 14/40 (35%), Positives = 24/40 (60%) Frame = +1 Query: 133 VDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGF 252 + L+ +T ED+++ FE G+V D + D+ T+ RGF Sbjct: 138 IGGLSATSTLEDMKQYFETYGKVEDAMLMFDKATQRHRGF 177 >AB036738-1|BAB13470.1| 320|Caenorhabditis elegans neural RNA-binding protein MSI-1 protein. Length = 320 Score = 38.7 bits (86), Expect = 0.002 Identities = 17/40 (42%), Positives = 26/40 (65%) Frame = +1 Query: 133 VDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGF 252 + L+++TT E+LR F R GEV + + RD T+ +RGF Sbjct: 49 IGGLSWQTTAENLRDYFGRFGEVNECMVMRDPATKRARGF 88 Score = 31.5 bits (68), Expect = 0.35 Identities = 14/40 (35%), Positives = 24/40 (60%) Frame = +1 Query: 133 VDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGF 252 + L+ +T ED+++ FE G+V D + D+ T+ RGF Sbjct: 138 IGGLSATSTLEDMKQYFETYGKVEDAMLMFDKATQRHRGF 177 >U23484-11|AAC46764.2| 191|Caenorhabditis elegans Hypothetical protein EEED8.4 protein. Length = 191 Score = 37.9 bits (84), Expect = 0.004 Identities = 13/44 (29%), Positives = 29/44 (65%) Frame = +1 Query: 124 SLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFA 255 S+ + N+ + +T E++ F+ CG++ IP+D++T++ + FA Sbjct: 56 SVFIGNVDFNSTIEEIEEHFKGCGQIVKTTIPKDKFTKKQKNFA 99 >D10877-1|BAA01645.1| 346|Caenorhabditis elegans hnRNP like protein protein. Length = 346 Score = 37.9 bits (84), Expect = 0.004 Identities = 19/46 (41%), Positives = 26/46 (56%) Frame = +1 Query: 133 VDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAS*GFS 270 V LT TT + +R + + GE+ DI + RD T+ SRGF FS Sbjct: 27 VGGLTSNTTDDLMREFYSQFGEITDIIVMRDPTTKRSRGFGFVTFS 72 >AF038613-6|ABB51186.1| 347|Caenorhabditis elegans Human hnrnp a1 homolog protein1, isoform d protein. Length = 347 Score = 37.9 bits (84), Expect = 0.004 Identities = 19/46 (41%), Positives = 26/46 (56%) Frame = +1 Query: 133 VDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAS*GFS 270 V LT TT + +R + + GE+ DI + RD T+ SRGF FS Sbjct: 27 VGGLTSNTTDDLMREFYSQFGEITDIIVMRDPTTKRSRGFGFVTFS 72 >AF038613-5|AAB92051.1| 346|Caenorhabditis elegans Human hnrnp a1 homolog protein1, isoform a protein. Length = 346 Score = 37.9 bits (84), Expect = 0.004 Identities = 19/46 (41%), Positives = 26/46 (56%) Frame = +1 Query: 133 VDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAS*GFS 270 V LT TT + +R + + GE+ DI + RD T+ SRGF FS Sbjct: 27 VGGLTSNTTDDLMREFYSQFGEITDIIVMRDPTTKRSRGFGFVTFS 72 >Z81108-4|CAB03237.1| 85|Caenorhabditis elegans Hypothetical protein R09B3.3 protein. Length = 85 Score = 37.1 bits (82), Expect = 0.007 Identities = 18/44 (40%), Positives = 25/44 (56%) Frame = +1 Query: 124 SLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFA 255 S+ V N ++TT +DL F + G V ++ I DR T RGFA Sbjct: 5 SVYVGNAPFQTTEDDLGNYFSQAGNVSNVRIVCDRETGRPRGFA 48 >Z81037-3|CAB02750.1| 205|Caenorhabditis elegans Hypothetical protein C17E4.5 protein. Length = 205 Score = 36.3 bits (80), Expect = 0.012 Identities = 16/44 (36%), Positives = 25/44 (56%) Frame = +1 Query: 124 SLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFA 255 S+ V N+ Y T E++ + F CG V + I DR++ +GFA Sbjct: 79 SVYVGNVDYGATAEEIEQHFHGCGSVSRVTIQCDRFSGHPKGFA 122 >U23484-10|AAC46772.1| 197|Caenorhabditis elegans Hypothetical protein EEED8.12 protein. Length = 197 Score = 36.3 bits (80), Expect = 0.012 Identities = 13/44 (29%), Positives = 28/44 (63%) Frame = +1 Query: 124 SLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFA 255 S+ + N+ + +T E++ F+ CG + IP+D++T++ + FA Sbjct: 62 SVFIGNVDFNSTIEEVEEHFKGCGHIVRTTIPKDKFTKKQKNFA 105 >AF038623-4|AAO91699.1| 177|Caenorhabditis elegans Hypothetical protein T08B6.5 protein. Length = 177 Score = 35.9 bits (79), Expect = 0.016 Identities = 14/44 (31%), Positives = 27/44 (61%) Frame = +1 Query: 124 SLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFA 255 S+ V N+ +++T ++ F CG+V + IP+D++T + FA Sbjct: 47 SVYVGNVDWKSTVSEIEEHFAVCGKVARVTIPKDKFTGYQKNFA 90 >Z83127-4|CAB05631.1| 872|Caenorhabditis elegans Hypothetical protein T23F6.4 protein. Length = 872 Score = 35.5 bits (78), Expect = 0.022 Identities = 15/39 (38%), Positives = 25/39 (64%) Frame = +1 Query: 139 NLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFA 255 NL Y T +DL+ +F++ GEV ++ + D+ T +GFA Sbjct: 285 NLPYATKEDDLQFLFKKYGEVSEVQVVIDKKTGACKGFA 323 >Z92826-4|CAB07322.1| 309|Caenorhabditis elegans Hypothetical protein C18D11.4 protein. Length = 309 Score = 33.9 bits (74), Expect = 0.066 Identities = 19/42 (45%), Positives = 24/42 (57%) Frame = +1 Query: 127 LKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGF 252 L V NL+ TT +DLR VF GE+ + DR + SRGF Sbjct: 78 LGVFNLSSYTTEKDLRDVFGEFGEINKCDLVYDRPSGNSRGF 119 >AF047662-1|AAC04442.1| 248|Caenorhabditis elegans Suppressor protein 12 protein. Length = 248 Score = 33.5 bits (73), Expect = 0.087 Identities = 14/40 (35%), Positives = 24/40 (60%) Frame = +1 Query: 133 VDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGF 252 V L Y T+ + L FE+ G++ + + DR T++SRG+ Sbjct: 39 VGGLPYHTSDKTLHEYFEQFGDIEEAVVITDRNTQKSRGY 78 >U41531-7|AAA83161.2| 415|Caenorhabditis elegans Feminizing gene on x protein 1 protein. Length = 415 Score = 33.1 bits (72), Expect = 0.12 Identities = 23/61 (37%), Positives = 34/61 (55%) Frame = +1 Query: 112 DGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAS*GFSXVVTLKK 291 DG L V N+ +R DL+ +FE+ G V D+ I + R S+GF GF VT+++ Sbjct: 150 DGPKRLHVSNIPFRFRDPDLKTMFEKFGVVSDVEIIFNE--RGSKGF---GF---VTMER 201 Query: 292 P 294 P Sbjct: 202 P 202 >U23450-2|AAK31468.1| 302|Caenorhabditis elegans Hypothetical protein C30B5.4 protein. Length = 302 Score = 33.1 bits (72), Expect = 0.12 Identities = 16/41 (39%), Positives = 26/41 (63%) Frame = +1 Query: 133 VDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFA 255 + L+Y + D+ VF + GEV +I + RD+ T +S+GFA Sbjct: 42 IGGLSYALSEGDVIAVFSQYGEVMNINLIRDKDTGKSKGFA 82 >U14946-1|AAA67723.1| 415|Caenorhabditis elegans ribonucleoprotein protein. Length = 415 Score = 33.1 bits (72), Expect = 0.12 Identities = 23/61 (37%), Positives = 34/61 (55%) Frame = +1 Query: 112 DGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAS*GFSXVVTLKK 291 DG L V N+ +R DL+ +FE+ G V D+ I + R S+GF GF VT+++ Sbjct: 150 DGPKRLHVSNIPFRFRDPDLKTMFEKFGVVSDVEIIFNE--RGSKGF---GF---VTMER 201 Query: 292 P 294 P Sbjct: 202 P 202 >Z50044-2|CAA90354.1| 256|Caenorhabditis elegans Hypothetical protein F22B5.2 protein. Length = 256 Score = 32.7 bits (71), Expect = 0.15 Identities = 16/42 (38%), Positives = 24/42 (57%) Frame = +1 Query: 130 KVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFA 255 +V NL ++LR +F + G V I+I RD+ T +GFA Sbjct: 179 RVTNLPQEMNEDELRDLFGKIGRVIRIFIARDKVTGLPKGFA 220 >AC084197-11|AAM44397.1| 305|Caenorhabditis elegans Homologous to drosophila sqd (squid)protein protein 1, isoform a protein. Length = 305 Score = 31.9 bits (69), Expect = 0.27 Identities = 15/31 (48%), Positives = 20/31 (64%) Frame = +1 Query: 163 EDLRRVFERCGEVGDIYIPRDRYTRESRGFA 255 +DLR FE+ G+V DI P D+ T+ R FA Sbjct: 124 QDLRSHFEQFGKVDDIEWPFDKQTKARRNFA 154 Score = 28.3 bits (60), Expect = 3.3 Identities = 15/41 (36%), Positives = 19/41 (46%) Frame = +1 Query: 133 VDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFA 255 V ++ EDL F + GEV + DR SRGFA Sbjct: 33 VGGISPEVNNEDLSSHFTQYGEVAQAQVKYDRTNGRSRGFA 73 >AC084197-10|AAY43984.1| 308|Caenorhabditis elegans Homologous to drosophila sqd (squid)protein protein 1, isoform b protein. Length = 308 Score = 31.9 bits (69), Expect = 0.27 Identities = 15/31 (48%), Positives = 20/31 (64%) Frame = +1 Query: 163 EDLRRVFERCGEVGDIYIPRDRYTRESRGFA 255 +DLR FE+ G+V DI P D+ T+ R FA Sbjct: 124 QDLRSHFEQFGKVDDIEWPFDKQTKARRNFA 154 Score = 28.3 bits (60), Expect = 3.3 Identities = 15/41 (36%), Positives = 19/41 (46%) Frame = +1 Query: 133 VDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFA 255 V ++ EDL F + GEV + DR SRGFA Sbjct: 33 VGGISPEVNNEDLSSHFTQYGEVAQAQVKYDRTNGRSRGFA 73 >AF038613-8|AAL02515.2| 309|Caenorhabditis elegans Human hnrnp a1 homolog protein1, isoform b protein. Length = 309 Score = 31.1 bits (67), Expect = 0.46 Identities = 14/34 (41%), Positives = 20/34 (58%) Frame = +1 Query: 169 LRRVFERCGEVGDIYIPRDRYTRESRGFAS*GFS 270 +R + + GE+ DI + RD T+ SRGF FS Sbjct: 1 MREFYSQFGEITDIIVMRDPTTKRSRGFGFVTFS 34 >AF038613-7|ABB51185.1| 308|Caenorhabditis elegans Human hnrnp a1 homolog protein1, isoform c protein. Length = 308 Score = 31.1 bits (67), Expect = 0.46 Identities = 14/34 (41%), Positives = 20/34 (58%) Frame = +1 Query: 169 LRRVFERCGEVGDIYIPRDRYTRESRGFAS*GFS 270 +R + + GE+ DI + RD T+ SRGF FS Sbjct: 1 MREFYSQFGEITDIIVMRDPTTKRSRGFGFVTFS 34 >Z81473-3|CAB03896.4| 514|Caenorhabditis elegans Hypothetical protein C17D12.2 protein. Length = 514 Score = 30.7 bits (66), Expect = 0.61 Identities = 15/52 (28%), Positives = 27/52 (51%) Frame = +1 Query: 100 PPRIDGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFA 255 P + + L V + +DLR +FE+ G++ + I +D+YT +G A Sbjct: 22 PVKDPDAIKLFVGQIPRNLEEKDLRHLFEQFGKIYEFTILKDKYTGMHKGCA 73 >AY342388-1|AAQ19851.1| 514|Caenorhabditis elegans putative RNA-binding protein protein. Length = 514 Score = 30.7 bits (66), Expect = 0.61 Identities = 15/52 (28%), Positives = 27/52 (51%) Frame = +1 Query: 100 PPRIDGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFA 255 P + + L V + +DLR +FE+ G++ + I +D+YT +G A Sbjct: 22 PVKDPDAIKLFVGQIPRNLEEKDLRHLFEQFGKIYEFTILKDKYTGMHKGCA 73 >Z97628-2|CAB10726.2| 427|Caenorhabditis elegans Hypothetical protein F39H2.2a protein. Length = 427 Score = 30.3 bits (65), Expect = 0.81 Identities = 14/34 (41%), Positives = 21/34 (61%) Frame = +1 Query: 154 TTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFA 255 TT EDL +F R G++ + I RDR + +S +A Sbjct: 252 TTDEDLEIIFSRFGKINNCEIVRDRRSGDSLQYA 285 >Z81080-5|CAB03088.2| 427|Caenorhabditis elegans Hypothetical protein F39H2.2a protein. Length = 427 Score = 30.3 bits (65), Expect = 0.81 Identities = 14/34 (41%), Positives = 21/34 (61%) Frame = +1 Query: 154 TTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFA 255 TT EDL +F R G++ + I RDR + +S +A Sbjct: 252 TTDEDLEIIFSRFGKINNCEIVRDRRSGDSLQYA 285 >Z81080-2|CAD56584.1| 358|Caenorhabditis elegans Hypothetical protein F39H2.2b protein. Length = 358 Score = 30.3 bits (65), Expect = 0.81 Identities = 14/34 (41%), Positives = 21/34 (61%) Frame = +1 Query: 154 TTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFA 255 TT EDL +F R G++ + I RDR + +S +A Sbjct: 183 TTDEDLEIIFSRFGKINNCEIVRDRRSGDSLQYA 216 >Z78419-2|CAB01702.1| 154|Caenorhabditis elegans Hypothetical protein F26A3.2 protein. Length = 154 Score = 30.3 bits (65), Expect = 0.81 Identities = 14/43 (32%), Positives = 24/43 (55%) Frame = +1 Query: 124 SLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGF 252 +L V NL+Y T + + +F R G+V + + DR+ + GF Sbjct: 38 TLYVGNLSYYTKEDQVYELFGRAGDVRRVIMGLDRFKKTPCGF 80 >Z36238-3|CAA85276.1| 404|Caenorhabditis elegans Hypothetical protein R74.5a protein. Length = 404 Score = 29.1 bits (62), Expect = 1.9 Identities = 22/61 (36%), Positives = 32/61 (52%) Frame = +1 Query: 112 DGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAS*GFSXVVTLKK 291 DG L V N+ ++ DL +FE+ G V D+ I + R S+GF GF VT++ Sbjct: 97 DGPRRLHVSNIPFKYREPDLTAMFEKVGPVVDVEIIFNE--RGSKGF---GF---VTMQN 148 Query: 292 P 294 P Sbjct: 149 P 149 >DQ485531-1|ABF22491.1| 404|Caenorhabditis elegans RNA-binding protein ASD-1 protein. Length = 404 Score = 29.1 bits (62), Expect = 1.9 Identities = 22/61 (36%), Positives = 32/61 (52%) Frame = +1 Query: 112 DGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAS*GFSXVVTLKK 291 DG L V N+ ++ DL +FE+ G V D+ I + R S+GF GF VT++ Sbjct: 97 DGPRRLHVSNIPFKYREPDLTAMFEKVGPVVDVEIIFNE--RGSKGF---GF---VTMQN 148 Query: 292 P 294 P Sbjct: 149 P 149 >Z36752-6|CAA85327.1| 456|Caenorhabditis elegans Hypothetical protein F35H8.5 protein. Length = 456 Score = 28.7 bits (61), Expect = 2.5 Identities = 13/47 (27%), Positives = 25/47 (53%) Frame = +1 Query: 112 DGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGF 252 + +L ++ L T E++R +F GE+ + RD+ T +S G+ Sbjct: 39 ESKTNLIINYLPQGMTQEEVRSLFTSIGEIESCKLVRDKVTGQSLGY 85 >U80455-1|AAB37881.1| 584|Caenorhabditis elegans Elav-type rna binding protein familyprotein 1, isoform a protein. Length = 584 Score = 28.7 bits (61), Expect = 2.5 Identities = 14/43 (32%), Positives = 23/43 (53%) Frame = +1 Query: 121 VSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRG 249 + + V + + D RR+FE+ G V I RD+ T+ S+G Sbjct: 55 IKMFVGQIPRQWNETDCRRLFEKYGSVFSCNILRDKSTQASKG 97 >U53931-1|AAA98566.1| 584|Caenorhabditis elegans elav-type ribonucleoprotein protein. Length = 584 Score = 28.7 bits (61), Expect = 2.5 Identities = 14/43 (32%), Positives = 23/43 (53%) Frame = +1 Query: 121 VSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRG 249 + + V + + D RR+FE+ G V I RD+ T+ S+G Sbjct: 55 IKMFVGQIPRQWNETDCRRLFEKYGSVFSCNILRDKSTQASKG 97 >U28944-7|AAN63457.1| 295|Caenorhabditis elegans Hypothetical protein C18A3.5f protein. Length = 295 Score = 28.7 bits (61), Expect = 2.5 Identities = 13/40 (32%), Positives = 22/40 (55%) Frame = +1 Query: 133 VDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGF 252 V +L+ + LR F+ G+V D + RD T +S+G+ Sbjct: 26 VGDLSSEVDNQKLREAFQPFGDVSDAKVIRDTNTTKSKGY 65 >U28944-6|AAN63456.1| 305|Caenorhabditis elegans Hypothetical protein C18A3.5e protein. Length = 305 Score = 28.7 bits (61), Expect = 2.5 Identities = 13/40 (32%), Positives = 22/40 (55%) Frame = +1 Query: 133 VDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGF 252 V +L+ + LR F+ G+V D + RD T +S+G+ Sbjct: 36 VGDLSSEVDNQKLREAFQPFGDVSDAKVIRDTNTTKSKGY 75 >U28944-5|AAK68191.1| 408|Caenorhabditis elegans Hypothetical protein C18A3.5a protein. Length = 408 Score = 28.7 bits (61), Expect = 2.5 Identities = 13/40 (32%), Positives = 22/40 (55%) Frame = +1 Query: 133 VDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGF 252 V +L+ + LR F+ G+V D + RD T +S+G+ Sbjct: 139 VGDLSSEVDNQKLREAFQPFGDVSDAKVIRDTNTTKSKGY 178 >U28944-4|AAK68192.1| 376|Caenorhabditis elegans Hypothetical protein C18A3.5b protein. Length = 376 Score = 28.7 bits (61), Expect = 2.5 Identities = 13/40 (32%), Positives = 22/40 (55%) Frame = +1 Query: 133 VDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGF 252 V +L+ + LR F+ G+V D + RD T +S+G+ Sbjct: 107 VGDLSSEVDNQKLREAFQPFGDVSDAKVIRDTNTTKSKGY 146 >EF523770-1|ABS18836.1| 513|Caenorhabditis elegans ELAV-type RNA binding protein variantE protein. Length = 513 Score = 28.7 bits (61), Expect = 2.5 Identities = 14/43 (32%), Positives = 23/43 (53%) Frame = +1 Query: 121 VSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRG 249 + + V + + D RR+FE+ G V I RD+ T+ S+G Sbjct: 55 IKMFVGQIPRQWNETDCRRLFEKYGSVFSCNILRDKSTQASKG 97 >EF523769-1|ABS18835.1| 327|Caenorhabditis elegans ELAV-type RNA binding protein variantD protein. Length = 327 Score = 28.7 bits (61), Expect = 2.5 Identities = 14/43 (32%), Positives = 23/43 (53%) Frame = +1 Query: 121 VSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRG 249 + + V + + D RR+FE+ G V I RD+ T+ S+G Sbjct: 55 IKMFVGQIPRQWNETDCRRLFEKYGSVFSCNILRDKSTQASKG 97 >EF523768-1|ABS18834.1| 378|Caenorhabditis elegans ELAV-type RNA binding protein variantC protein. Length = 378 Score = 28.7 bits (61), Expect = 2.5 Identities = 14/43 (32%), Positives = 23/43 (53%) Frame = +1 Query: 121 VSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRG 249 + + V + + D RR+FE+ G V I RD+ T+ S+G Sbjct: 55 IKMFVGQIPRQWNETDCRRLFEKYGSVFSCNILRDKSTQASKG 97 >EF523767-1|ABS18833.1| 193|Caenorhabditis elegans ELAV-type RNA binding protein variantB protein. Length = 193 Score = 28.7 bits (61), Expect = 2.5 Identities = 14/43 (32%), Positives = 23/43 (53%) Frame = +1 Query: 121 VSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRG 249 + + V + + D RR+FE+ G V I RD+ T+ S+G Sbjct: 55 IKMFVGQIPRQWNETDCRRLFEKYGSVFSCNILRDKSTQASKG 97 >EF523766-1|ABS18832.1| 584|Caenorhabditis elegans ELAV-type RNA binding protein variantA protein. Length = 584 Score = 28.7 bits (61), Expect = 2.5 Identities = 14/43 (32%), Positives = 23/43 (53%) Frame = +1 Query: 121 VSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRG 249 + + V + + D RR+FE+ G V I RD+ T+ S+G Sbjct: 55 IKMFVGQIPRQWNETDCRRLFEKYGSVFSCNILRDKSTQASKG 97 >Z78536-3|CAB01717.2| 360|Caenorhabditis elegans Hypothetical protein C07A4.1 protein. Length = 360 Score = 27.5 bits (58), Expect = 5.7 Identities = 13/40 (32%), Positives = 24/40 (60%) Frame = +1 Query: 133 VDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGF 252 V +L+ + E L+ F + GEV + + RD T++S+G+ Sbjct: 139 VGDLSKDVSNELLKSTFTKFGEVSEAKVIRDVQTQKSKGY 178 >AC024826-10|AAM97977.1| 435|Caenorhabditis elegans Hypothetical protein Y55F3AM.3c protein. Length = 435 Score = 27.1 bits (57), Expect = 7.6 Identities = 14/42 (33%), Positives = 19/42 (45%) Frame = +1 Query: 124 SLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRG 249 +L + + T P DL F G V D+ I D T S+G Sbjct: 26 TLLIMQIARDTRPRDLEEFFSAVGAVRDVRIITDSRTGRSKG 67 >AC024826-8|AAF60795.2| 580|Caenorhabditis elegans Hypothetical protein Y55F3AM.3a protein. Length = 580 Score = 27.1 bits (57), Expect = 7.6 Identities = 14/42 (33%), Positives = 19/42 (45%) Frame = +1 Query: 124 SLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRG 249 +L + + T P DL F G V D+ I D T S+G Sbjct: 171 TLLIMQIARDTRPRDLEEFFSAVGAVRDVRIITDSRTGRSKG 212 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,410,304 Number of Sequences: 27780 Number of extensions: 172721 Number of successful extensions: 414 Number of sequences better than 10.0: 46 Number of HSP's better than 10.0 without gapping: 399 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 414 length of database: 12,740,198 effective HSP length: 76 effective length of database: 10,628,918 effective search space used: 945973702 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -