SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30166.Seq
         (892 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U41542-8|AAN39682.1|  437|Caenorhabditis elegans Protein disulfi...   100   2e-21
U41542-7|ABO16445.1|  371|Caenorhabditis elegans Protein disulfi...    99   2e-21
U41542-6|AAK39152.1|  493|Caenorhabditis elegans Protein disulfi...    99   2e-21
Z37139-1|CAA85491.1|  485|Caenorhabditis elegans Hypothetical pr...    96   3e-20
U95074-1|AAB94647.1|  485|Caenorhabditis elegans protein disulph...    96   3e-20
L15188-9|AAM22024.1|  618|Caenorhabditis elegans Hypothetical pr...    79   6e-15
Z92970-1|CAB07480.1|  488|Caenorhabditis elegans Hypothetical pr...    77   1e-14
AB072567-1|BAB88817.1|  488|Caenorhabditis elegans ceERp57 protein.    77   1e-14
AC006834-9|AAL11490.1|  447|Caenorhabditis elegans Hypothetical ...    66   2e-11
U40411-4|AAC47065.1|  440|Caenorhabditis elegans Temporarily ass...    66   4e-11
Z98866-5|CAB11548.1|  436|Caenorhabditis elegans Hypothetical pr...    57   1e-08
AC084197-8|AAG23476.1|  228|Caenorhabditis elegans Hypothetical ...    48   7e-06
AL032657-16|CAJ85780.1|  318|Caenorhabditis elegans Hypothetical...    48   9e-06
AL032657-15|CAA21734.1|  788|Caenorhabditis elegans Hypothetical...    48   9e-06
Z69637-1|CAA93467.1|  601|Caenorhabditis elegans Hypothetical pr...    46   3e-05
U80848-2|AAB37989.1|  574|Caenorhabditis elegans Hypothetical pr...    45   8e-05
U23168-6|AAP86623.1|  114|Caenorhabditis elegans Hypothetical pr...    43   3e-04
DQ241300-1|ABB45864.1|  114|Caenorhabditis elegans TRX-1b protein.     43   3e-04
U97402-2|AAB63409.2|  393|Caenorhabditis elegans Hypothetical pr...    42   4e-04
U97402-1|ABB51193.1|  393|Caenorhabditis elegans Hypothetical pr...    42   4e-04
U23168-7|AAC38808.1|  115|Caenorhabditis elegans Hypothetical pr...    41   0.001
DQ241299-1|ABB45863.1|  115|Caenorhabditis elegans TRX-1a protein.     41   0.001
U41012-4|AAA82296.2|  413|Caenorhabditis elegans Hypothetical pr...    40   0.003
Z69792-2|CAA93667.1|  417|Caenorhabditis elegans Hypothetical pr...    38   0.013
U39646-7|AAA80371.1|  623|Caenorhabditis elegans Hypothetical pr...    36   0.029
U39646-6|AAK72058.1|  624|Caenorhabditis elegans Hypothetical pr...    36   0.029
U39646-5|AAK72057.1|  678|Caenorhabditis elegans Hypothetical pr...    36   0.029
Z71178-7|CAA94881.1|  119|Caenorhabditis elegans Hypothetical pr...    36   0.039
AF250045-1|AAG17620.1|  246|Caenorhabditis elegans thioredoxin-l...    36   0.051
AF125955-2|AAD14719.1|  246|Caenorhabditis elegans Dumpy : short...    36   0.051
U88167-3|AAB42224.2|  363|Caenorhabditis elegans Hypothetical pr...    34   0.16 
AL110477-15|CAB54331.2|  295|Caenorhabditis elegans Hypothetical...    34   0.16 
Z81044-3|CAB02808.1|  178|Caenorhabditis elegans Hypothetical pr...    33   0.36 
AF143900-1|AAF66677.1|  284|Caenorhabditis elegans thioredoxin-l...    32   0.63 
AF143405-1|AAF66636.1|  284|Caenorhabditis elegans thioredoxin-l...    32   0.63 
AC024810-17|AAF60759.1|  284|Caenorhabditis elegans Hypothetical...    32   0.63 
U50135-4|AAA93455.3| 1487|Caenorhabditis elegans Hypothetical pr...    31   0.84 
Z81552-7|CAB04487.2|  606|Caenorhabditis elegans Hypothetical pr...    31   1.1  
AL117201-5|CAB57916.1|  606|Caenorhabditis elegans Hypothetical ...    31   1.1  
AF125951-5|AAL27238.1|  345|Caenorhabditis elegans Hypothetical ...    30   1.9  
AF125951-4|AAT68898.1|  342|Caenorhabditis elegans Hypothetical ...    30   1.9  
AC024827-2|AAF60805.2|  254|Caenorhabditis elegans Hypothetical ...    30   1.9  
AF016415-9|AAW88416.1|  297|Caenorhabditis elegans Serpentine re...    30   2.6  
Z70686-12|CAB54289.1| 2584|Caenorhabditis elegans Hypothetical p...    29   3.4  
Z70686-11|CAA94615.1| 2606|Caenorhabditis elegans Hypothetical p...    29   3.4  
Z70686-8|CAM35837.1| 1427|Caenorhabditis elegans Hypothetical pr...    29   3.4  
Z70686-7|CAM35836.1| 1405|Caenorhabditis elegans Hypothetical pr...    29   3.4  
Z70310-9|CAB54294.1| 2584|Caenorhabditis elegans Hypothetical pr...    29   3.4  
Z70310-8|CAA94370.1| 2606|Caenorhabditis elegans Hypothetical pr...    29   3.4  
AF106589-2|AAC78230.1|  107|Caenorhabditis elegans Hypothetical ...    28   7.8  
AF039049-10|AAB94247.1|  548|Caenorhabditis elegans Cytochrome p...    28   7.8  

>U41542-8|AAN39682.1|  437|Caenorhabditis elegans Protein disulfide
           isomerase protein2, isoform b protein.
          Length = 437

 Score =  100 bits (239), Expect = 2e-21
 Identities = 47/97 (48%), Positives = 62/97 (63%)
 Frame = +1

Query: 256 SPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPA 435
           S IKL K+DAT   +++  + VRGYPTLK FRNG P +Y+GGR  D II+WLKKKTGP A
Sbjct: 74  SDIKLGKLDATVHGEVSSKFEVRGYPTLKLFRNGKPQEYNGGRDHDSIIAWLKKKTGPVA 133

Query: 436 VEVTSAEQAKELIDANTVIVFGFFWTRAQPEPKLSFQ 546
             +  A+  KEL ++  V+V G+F      + K   Q
Sbjct: 134 KPLADADAVKELQESADVVVIGYFKDTTSDDAKTWIQ 170



 Score = 94.3 bits (224), Expect = 1e-19
 Identities = 45/72 (62%), Positives = 53/72 (73%), Gaps = 3/72 (4%)
 Frame = +2

Query: 47  IFTAIALLGLALGDE---VPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAP 217
           +F  + L  L LG     +  EENV+VL+K NF+ VI   E+ILVEFYAPWCGHCKSLAP
Sbjct: 1   MFRLVGLFFLVLGASAAVIEEEENVIVLTKDNFDEVINGNEFILVEFYAPWCGHCKSLAP 60

Query: 218 EYAKAATKLAEE 253
           EYAKAAT+L EE
Sbjct: 61  EYAKAATQLKEE 72



 Score = 58.4 bits (135), Expect = 6e-09
 Identities = 26/50 (52%), Positives = 33/50 (66%), Gaps = 1/50 (2%)
 Frame = +2

Query: 110 VLVLSKANFETVIT-TTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEED 256
           V +L   NFE V    T+ +LVEFYAPWCGHCK LAP + K   K A+++
Sbjct: 309 VKILVGKNFEQVARDNTKNVLVEFYAPWCGHCKQLAPTWDKLGEKFADDE 358



 Score = 37.5 bits (83), Expect = 0.013
 Identities = 24/70 (34%), Positives = 38/70 (54%), Gaps = 4/70 (5%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGS--PIDYSGGRQADDIISWLKK--KTGP 429
           I +AK+D+T  +   E   ++ +PT+KFF  GS   +DY+G R  +    +L+   K G 
Sbjct: 360 IVIAKMDSTLNE--VEDVKIQSFPTIKFFPAGSNKVVDYTGDRTIEGFTKFLETNGKEGA 417

Query: 430 PAVEVTSAEQ 459
            A E   AE+
Sbjct: 418 GASEEEKAEE 427


>U41542-7|ABO16445.1|  371|Caenorhabditis elegans Protein disulfide
           isomerase protein2, isoform c protein.
          Length = 371

 Score =   99 bits (238), Expect = 2e-21
 Identities = 45/84 (53%), Positives = 59/84 (70%)
 Frame = +1

Query: 256 SPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPA 435
           S IKL K+DAT   +++  + VRGYPTLK FRNG P +Y+GGR  D II+WLKKKTGP A
Sbjct: 74  SDIKLGKLDATVHGEVSSKFEVRGYPTLKLFRNGKPQEYNGGRDHDSIIAWLKKKTGPVA 133

Query: 436 VEVTSAEQAKELIDANTVIVFGFF 507
             +  A+  KEL ++  V+V G+F
Sbjct: 134 KPLADADAVKELQESADVVVIGYF 157



 Score = 94.3 bits (224), Expect = 1e-19
 Identities = 45/72 (62%), Positives = 53/72 (73%), Gaps = 3/72 (4%)
 Frame = +2

Query: 47  IFTAIALLGLALGDE---VPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAP 217
           +F  + L  L LG     +  EENV+VL+K NF+ VI   E+ILVEFYAPWCGHCKSLAP
Sbjct: 1   MFRLVGLFFLVLGASAAVIEEEENVIVLTKDNFDEVINGNEFILVEFYAPWCGHCKSLAP 60

Query: 218 EYAKAATKLAEE 253
           EYAKAAT+L EE
Sbjct: 61  EYAKAATQLKEE 72



 Score = 58.4 bits (135), Expect = 6e-09
 Identities = 26/50 (52%), Positives = 33/50 (66%), Gaps = 1/50 (2%)
 Frame = +2

Query: 110 VLVLSKANFETVIT-TTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEED 256
           V +L   NFE V    T+ +LVEFYAPWCGHCK LAP + K   K A+++
Sbjct: 243 VKILVGKNFEQVARDNTKNVLVEFYAPWCGHCKQLAPTWDKLGEKFADDE 292



 Score = 37.5 bits (83), Expect = 0.013
 Identities = 24/70 (34%), Positives = 38/70 (54%), Gaps = 4/70 (5%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGS--PIDYSGGRQADDIISWLKK--KTGP 429
           I +AK+D+T  +   E   ++ +PT+KFF  GS   +DY+G R  +    +L+   K G 
Sbjct: 294 IVIAKMDSTLNE--VEDVKIQSFPTIKFFPAGSNKVVDYTGDRTIEGFTKFLETNGKEGA 351

Query: 430 PAVEVTSAEQ 459
            A E   AE+
Sbjct: 352 GASEEEKAEE 361


>U41542-6|AAK39152.1|  493|Caenorhabditis elegans Protein disulfide
           isomerase protein2, isoform a protein.
          Length = 493

 Score =   99 bits (238), Expect = 2e-21
 Identities = 45/84 (53%), Positives = 59/84 (70%)
 Frame = +1

Query: 256 SPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPA 435
           S IKL K+DAT   +++  + VRGYPTLK FRNG P +Y+GGR  D II+WLKKKTGP A
Sbjct: 74  SDIKLGKLDATVHGEVSSKFEVRGYPTLKLFRNGKPQEYNGGRDHDSIIAWLKKKTGPVA 133

Query: 436 VEVTSAEQAKELIDANTVIVFGFF 507
             +  A+  KEL ++  V+V G+F
Sbjct: 134 KPLADADAVKELQESADVVVIGYF 157



 Score = 94.3 bits (224), Expect = 1e-19
 Identities = 45/72 (62%), Positives = 53/72 (73%), Gaps = 3/72 (4%)
 Frame = +2

Query: 47  IFTAIALLGLALGDE---VPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAP 217
           +F  + L  L LG     +  EENV+VL+K NF+ VI   E+ILVEFYAPWCGHCKSLAP
Sbjct: 1   MFRLVGLFFLVLGASAAVIEEEENVIVLTKDNFDEVINGNEFILVEFYAPWCGHCKSLAP 60

Query: 218 EYAKAATKLAEE 253
           EYAKAAT+L EE
Sbjct: 61  EYAKAATQLKEE 72



 Score = 58.4 bits (135), Expect = 6e-09
 Identities = 26/50 (52%), Positives = 33/50 (66%), Gaps = 1/50 (2%)
 Frame = +2

Query: 110 VLVLSKANFETVIT-TTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEED 256
           V +L   NFE V    T+ +LVEFYAPWCGHCK LAP + K   K A+++
Sbjct: 365 VKILVGKNFEQVARDNTKNVLVEFYAPWCGHCKQLAPTWDKLGEKFADDE 414



 Score = 56.0 bits (129), Expect = 3e-08
 Identities = 28/67 (41%), Positives = 43/67 (64%)
 Frame = +3

Query: 495 IWFLLDQSSARAKTFLSTAQVVDDQVFAIVSDEKVIKELEAEDEDVVLFKNFEEKRVKYX 674
           I +  D +S  AKTFL  A  +DD  F I +++ V  E+E + E +VLFK F++ RV + 
Sbjct: 154 IGYFKDTTSDDAKTFLEVAAGIDDVPFGISTEDAVKSEIELKGEGIVLFKKFDDGRVAF- 212

Query: 675 DEEITED 695
           DE++T+D
Sbjct: 213 DEKLTQD 219



 Score = 37.5 bits (83), Expect = 0.013
 Identities = 24/70 (34%), Positives = 38/70 (54%), Gaps = 4/70 (5%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGS--PIDYSGGRQADDIISWLKK--KTGP 429
           I +AK+D+T  +   E   ++ +PT+KFF  GS   +DY+G R  +    +L+   K G 
Sbjct: 416 IVIAKMDSTLNE--VEDVKIQSFPTIKFFPAGSNKVVDYTGDRTIEGFTKFLETNGKEGA 473

Query: 430 PAVEVTSAEQ 459
            A E   AE+
Sbjct: 474 GASEEEKAEE 483


>Z37139-1|CAA85491.1|  485|Caenorhabditis elegans Hypothetical
           protein C14B1.1 protein.
          Length = 485

 Score = 96.3 bits (229), Expect = 3e-20
 Identities = 43/84 (51%), Positives = 56/84 (66%)
 Frame = +1

Query: 256 SPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPA 435
           S IKLAKVDAT+ Q LA  + VRGYPT+ +F++G P  Y+GGR    I+ W+KKK+GP  
Sbjct: 74  SDIKLAKVDATENQALASKFEVRGYPTILYFKSGKPTKYTGGRATAQIVDWVKKKSGPTV 133

Query: 436 VEVTSAEQAKELIDANTVIVFGFF 507
             V S EQ +EL     V+V G+F
Sbjct: 134 TTVESVEQLEELKGKTRVVVLGYF 157



 Score = 79.8 bits (188), Expect = 2e-15
 Identities = 37/65 (56%), Positives = 47/65 (72%)
 Frame = +2

Query: 59  IALLGLALGDEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAAT 238
           I LL  ++G  V   ENVLVL+++NFE  I   E++LV+FYAPWC HCKSLAP+Y +AA 
Sbjct: 8   IFLLVASIGAVVADSENVLVLTESNFEETINGNEFVLVKFYAPWCVHCKSLAPKYDEAAD 67

Query: 239 KLAEE 253
            L EE
Sbjct: 68  LLKEE 72



 Score = 50.4 bits (115), Expect = 2e-06
 Identities = 24/55 (43%), Positives = 34/55 (61%), Gaps = 4/55 (7%)
 Frame = +2

Query: 89  EVPTEENVL---VLSKANF-ETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATK 241
           ++P + N L   VL  +NF E  +  T+ + V+FYAPWCGHCK L P + + A K
Sbjct: 355 DLPEDWNALPVKVLVASNFNEIALDETKTVFVKFYAPWCGHCKQLVPVWDELAEK 409



 Score = 39.5 bits (88), Expect = 0.003
 Identities = 24/72 (33%), Positives = 40/72 (55%), Gaps = 2/72 (2%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGS--PIDYSGGRQADDIISWLKKKTGPPA 435
           + +AK+DAT  + LA+   V  +PTLK +  GS  P+DY G R  +    ++ K  G  +
Sbjct: 416 VVIAKLDATLNE-LAD-VKVNSFPTLKLWPAGSSTPVDYDGDRNLEKFEEFVNKYAGSAS 473

Query: 436 VEVTSAEQAKEL 471
              T+++  +EL
Sbjct: 474 ESETASQDHEEL 485


>U95074-1|AAB94647.1|  485|Caenorhabditis elegans protein disulphide
           isomerase isoformI protein.
          Length = 485

 Score = 96.3 bits (229), Expect = 3e-20
 Identities = 43/84 (51%), Positives = 56/84 (66%)
 Frame = +1

Query: 256 SPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPA 435
           S IKLAKVDAT+ Q LA  + VRGYPT+ +F++G P  Y+GGR    I+ W+KKK+GP  
Sbjct: 74  SDIKLAKVDATENQALASKFEVRGYPTILYFKSGKPTKYTGGRATAQIVDWVKKKSGPTV 133

Query: 436 VEVTSAEQAKELIDANTVIVFGFF 507
             V S EQ +EL     V+V G+F
Sbjct: 134 TTVESVEQLEELKGKTRVVVLGYF 157



 Score = 79.8 bits (188), Expect = 2e-15
 Identities = 37/65 (56%), Positives = 47/65 (72%)
 Frame = +2

Query: 59  IALLGLALGDEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAAT 238
           I LL  ++G  V   ENVLVL+++NFE  I   E++LV+FYAPWC HCKSLAP+Y +AA 
Sbjct: 8   IFLLVASIGAVVADSENVLVLTESNFEETINGNEFVLVKFYAPWCVHCKSLAPKYDEAAD 67

Query: 239 KLAEE 253
            L EE
Sbjct: 68  LLKEE 72



 Score = 50.4 bits (115), Expect = 2e-06
 Identities = 24/55 (43%), Positives = 34/55 (61%), Gaps = 4/55 (7%)
 Frame = +2

Query: 89  EVPTEENVL---VLSKANF-ETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATK 241
           ++P + N L   VL  +NF E  +  T+ + V+FYAPWCGHCK L P + + A K
Sbjct: 355 DLPEDWNALPVKVLVASNFNEIALDETKTVFVKFYAPWCGHCKQLVPVWDELAEK 409



 Score = 39.5 bits (88), Expect = 0.003
 Identities = 24/72 (33%), Positives = 40/72 (55%), Gaps = 2/72 (2%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGS--PIDYSGGRQADDIISWLKKKTGPPA 435
           + +AK+DAT  + LA+   V  +PTLK +  GS  P+DY G R  +    ++ K  G  +
Sbjct: 416 VVIAKLDATLNE-LAD-VKVNSFPTLKLWPAGSSTPVDYDGDRNLEKFEEFVNKYAGSAS 473

Query: 436 VEVTSAEQAKEL 471
              T+++  +EL
Sbjct: 474 ESETASQDHEEL 485


>L15188-9|AAM22024.1|  618|Caenorhabditis elegans Hypothetical
           protein C14B9.2 protein.
          Length = 618

 Score = 78.6 bits (185), Expect = 6e-15
 Identities = 36/86 (41%), Positives = 52/86 (60%)
 Frame = +1

Query: 256 SPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPA 435
           S +KL KVDAT E+DL   YGV GYPT+K  RNG   DY+G R+A  II ++  ++ P A
Sbjct: 198 SKVKLGKVDATIEKDLGTKYGVSGYPTMKIIRNGRRFDYNGPREAAGIIKYMTDQSKPAA 257

Query: 436 VEVTSAEQAKELIDANTVIVFGFFWT 513
            ++   +  +  +  + V + GFF T
Sbjct: 258 KKLPKLKDVERFMSKDDVTIIGFFAT 283



 Score = 74.1 bits (174), Expect = 1e-13
 Identities = 31/50 (62%), Positives = 36/50 (72%)
 Frame = +2

Query: 95  PTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKL 244
           P  E V+ L+  NF+  I+  E +LVEFYAPWCGHCK LAPEY KAA KL
Sbjct: 144 PPPEEVVTLTTENFDDFISNNELVLVEFYAPWCGHCKKLAPEYEKAAQKL 193



 Score = 66.9 bits (156), Expect = 2e-11
 Identities = 26/49 (53%), Positives = 37/49 (75%)
 Frame = +2

Query: 101 EENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLA 247
           +E V+VL+  NF+  +     +LV+FYAPWCGHCK LAPEY KA++K++
Sbjct: 35  DEGVVVLTDKNFDAFLKKNPSVLVKFYAPWCGHCKHLAPEYEKASSKVS 83



 Score = 64.9 bits (151), Expect = 7e-11
 Identities = 34/89 (38%), Positives = 52/89 (58%), Gaps = 7/89 (7%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNG-SPIDYSGGRQADDIISWLKKKTG---- 426
           I LAKVDAT E +L + + ++GYPTLKF+++G  P DY GGR    I+ W++ +      
Sbjct: 84  IPLAKVDATVETELGKRFEIQGYPTLKFWKDGKGPNDYDGGRDEAGIVEWVESRVDPNYK 143

Query: 427 PPAVEVT--SAEQAKELIDANTVIVFGFF 507
           PP  EV   + E   + I  N +++  F+
Sbjct: 144 PPPEEVVTLTTENFDDFISNNELVLVEFY 172



 Score = 48.4 bits (110), Expect = 7e-06
 Identities = 18/40 (45%), Positives = 28/40 (70%), Gaps = 1/40 (2%)
 Frame = +2

Query: 128 ANFETVITT-TEYILVEFYAPWCGHCKSLAPEYAKAATKL 244
           +NF+ ++   ++ +L+EFYAPWCGHCKS   +Y + A  L
Sbjct: 507 SNFDKIVNDESKDVLIEFYAPWCGHCKSFESKYVELAQAL 546


>Z92970-1|CAB07480.1|  488|Caenorhabditis elegans Hypothetical
           protein H06O01.1 protein.
          Length = 488

 Score = 77.4 bits (182), Expect = 1e-14
 Identities = 33/84 (39%), Positives = 54/84 (64%), Gaps = 1/84 (1%)
 Frame = +1

Query: 259 PIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPI-DYSGGRQADDIISWLKKKTGPPA 435
           P+ L KVD T E+ + + +GV+G+PTLK FRNG P  DY G R AD I+ +++ ++GP +
Sbjct: 72  PVALVKVDCTTEKTVCDKFGVKGFPTLKIFRNGVPAQDYDGPRDADGIVKFMRGQSGPSS 131

Query: 436 VEVTSAEQAKELIDANTVIVFGFF 507
            E+ +  + ++    +  +V GFF
Sbjct: 132 KELKTVAEFEKFTGGDENVVIGFF 155



 Score = 67.7 bits (158), Expect = 1e-11
 Identities = 28/49 (57%), Positives = 35/49 (71%)
 Frame = +2

Query: 110 VLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEED 256
           VL  +  NF+ +I T +  LV+FYAPWCGHCK +APEY +AA KLA  D
Sbjct: 22  VLEYTDGNFDDLIQTHDIALVKFYAPWCGHCKKIAPEYERAAPKLASND 70



 Score = 64.5 bits (150), Expect = 1e-10
 Identities = 29/61 (47%), Positives = 43/61 (70%), Gaps = 2/61 (3%)
 Frame = +2

Query: 86  DEVPTEE-NVLVLSKANF-ETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEDL 259
           + +P E+ +V V    NF E ++   + +L+EFYAPWCGHCKSLAP+Y + A KL +ED+
Sbjct: 355 EPIPDEQGDVKVAVGKNFKELIMDADKDVLIEFYAPWCGHCKSLAPKYEELAEKLNKEDV 414

Query: 260 L 262
           +
Sbjct: 415 I 415



 Score = 42.3 bits (95), Expect = 4e-04
 Identities = 21/58 (36%), Positives = 35/58 (60%), Gaps = 3/58 (5%)
 Frame = +1

Query: 253 RSPIKLAKVDATQEQDLAESYGVRGYPTLKFF---RNGSPIDYSGGRQADDIISWLKK 417
           +  + +AK+DAT   D+   + VRG+PTL +       +PI Y+GGR+  D +S++ K
Sbjct: 411 KEDVIIAKMDATAN-DVPPMFEVRGFPTLFWLPKNAKSNPIPYNGGREVKDFVSFISK 467


>AB072567-1|BAB88817.1|  488|Caenorhabditis elegans ceERp57 protein.
          Length = 488

 Score = 77.4 bits (182), Expect = 1e-14
 Identities = 33/84 (39%), Positives = 54/84 (64%), Gaps = 1/84 (1%)
 Frame = +1

Query: 259 PIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPI-DYSGGRQADDIISWLKKKTGPPA 435
           P+ L KVD T E+ + + +GV+G+PTLK FRNG P  DY G R AD I+ +++ ++GP +
Sbjct: 72  PVALVKVDCTTEKTVCDKFGVKGFPTLKIFRNGVPAQDYDGPRDADGIVKFMRGQSGPSS 131

Query: 436 VEVTSAEQAKELIDANTVIVFGFF 507
            E+ +  + ++    +  +V GFF
Sbjct: 132 KELKTVAEFEKFTGGDENVVIGFF 155



 Score = 67.7 bits (158), Expect = 1e-11
 Identities = 28/49 (57%), Positives = 35/49 (71%)
 Frame = +2

Query: 110 VLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEED 256
           VL  +  NF+ +I T +  LV+FYAPWCGHCK +APEY +AA KLA  D
Sbjct: 22  VLEYTDGNFDDLIQTHDIALVKFYAPWCGHCKKIAPEYERAAPKLASND 70



 Score = 64.5 bits (150), Expect = 1e-10
 Identities = 29/61 (47%), Positives = 43/61 (70%), Gaps = 2/61 (3%)
 Frame = +2

Query: 86  DEVPTEE-NVLVLSKANF-ETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEDL 259
           + +P E+ +V V    NF E ++   + +L+EFYAPWCGHCKSLAP+Y + A KL +ED+
Sbjct: 355 EPIPDEQGDVKVAVGKNFKELIMDADKDVLIEFYAPWCGHCKSLAPKYEELAEKLNKEDV 414

Query: 260 L 262
           +
Sbjct: 415 I 415



 Score = 42.3 bits (95), Expect = 4e-04
 Identities = 21/58 (36%), Positives = 35/58 (60%), Gaps = 3/58 (5%)
 Frame = +1

Query: 253 RSPIKLAKVDATQEQDLAESYGVRGYPTLKFF---RNGSPIDYSGGRQADDIISWLKK 417
           +  + +AK+DAT   D+   + VRG+PTL +       +PI Y+GGR+  D +S++ K
Sbjct: 411 KEDVIIAKMDATAN-DVPPMFEVRGFPTLFWLPKNAKSNPIPYNGGREVKDFVSFISK 467


>AC006834-9|AAL11490.1|  447|Caenorhabditis elegans Hypothetical
           protein ZK973.11 protein.
          Length = 447

 Score = 66.5 bits (155), Expect = 2e-11
 Identities = 32/90 (35%), Positives = 55/90 (61%), Gaps = 1/90 (1%)
 Frame = +1

Query: 259 PIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAV 438
           PI++ K+D T+   +A    ++GYPT+ FFRNG  IDY GGR+ + ++S+  K+   P +
Sbjct: 78  PIRVGKLDCTRFPAVANKLSIQGYPTILFFRNGHVIDYRGGREKEALVSF-AKRCAAPII 136

Query: 439 EVTSAEQAKEL-IDANTVIVFGFFWTRAQP 525
           EV +  Q +++ + A +   + FF T + P
Sbjct: 137 EVINENQIEKVKLSARSQPSYVFFGTSSGP 166



 Score = 40.7 bits (91), Expect = 0.001
 Identities = 15/30 (50%), Positives = 20/30 (66%)
 Frame = +2

Query: 170 VEFYAPWCGHCKSLAPEYAKAATKLAEEDL 259
           VEFYAPWC HCK L P + +    L++ +L
Sbjct: 48  VEFYAPWCAHCKRLHPVWDQVGHTLSDSNL 77


>U40411-4|AAC47065.1|  440|Caenorhabditis elegans Temporarily
           assigned gene nameprotein 320 protein.
          Length = 440

 Score = 65.7 bits (153), Expect = 4e-11
 Identities = 28/49 (57%), Positives = 40/49 (81%), Gaps = 1/49 (2%)
 Frame = +2

Query: 101 EENVLVLSKANFET-VITTTEYILVEFYAPWCGHCKSLAPEYAKAATKL 244
           +++V+ L++ANF++ VI + +  +VEFYAPWCGHCKSL PEY KAA+ L
Sbjct: 23  KDDVVELTEANFQSKVINSDDIWIVEFYAPWCGHCKSLVPEYKKAASAL 71



 Score = 57.6 bits (133), Expect = 1e-08
 Identities = 25/46 (54%), Positives = 36/46 (78%), Gaps = 1/46 (2%)
 Frame = +2

Query: 110 VLVLSKANFETVITTTEYI-LVEFYAPWCGHCKSLAPEYAKAATKL 244
           V+ L+ ANFE ++  ++ I LVEF+APWCGHCKSL P++  AA++L
Sbjct: 166 VVELTDANFEDLVLNSKDIWLVEFFAPWCGHCKSLEPQWKAAASEL 211



 Score = 56.0 bits (129), Expect = 3e-08
 Identities = 28/82 (34%), Positives = 46/82 (56%), Gaps = 6/82 (7%)
 Frame = +1

Query: 253 RSPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPI----DYSGGRQADDIISW--LK 414
           +  ++L  +DAT    +A  + +RG+PT+K+F  GS +    DY GGRQ+ DI++W   +
Sbjct: 212 KGKVRLGALDATVHTVVANKFAIRGFPTIKYFAPGSDVSDAQDYDGGRQSSDIVAWASAR 271

Query: 415 KKTGPPAVEVTSAEQAKELIDA 480
            +   PA EV      + + DA
Sbjct: 272 AQENMPAPEVFEGINQQVVEDA 293



 Score = 41.1 bits (92), Expect = 0.001
 Identities = 21/47 (44%), Positives = 26/47 (55%), Gaps = 2/47 (4%)
 Frame = +1

Query: 265 KLAKVDATQEQDLAESYGVRGYPTLKFF--RNGSPIDYSGGRQADDI 399
           K+  VD TQ Q +   Y V+G+PTLK F      P DY+G R A  I
Sbjct: 76  KVGAVDMTQHQSVGGPYNVQGFPTLKIFGADKKKPTDYNGQRTAQAI 122


>Z98866-5|CAB11548.1|  436|Caenorhabditis elegans Hypothetical
           protein Y49E10.4 protein.
          Length = 436

 Score = 57.2 bits (132), Expect = 1e-08
 Identities = 25/49 (51%), Positives = 36/49 (73%), Gaps = 1/49 (2%)
 Frame = +2

Query: 101 EENVLVLSKANFETVITTTEYI-LVEFYAPWCGHCKSLAPEYAKAATKL 244
           +++V  L+ +NF+  +  ++ I +VEFYAP+CGHCKSL PEY KAA  L
Sbjct: 23  KDSVFELTDSNFDAKVLKSDRIWIVEFYAPYCGHCKSLVPEYKKAAKLL 71



 Score = 55.2 bits (127), Expect = 6e-08
 Identities = 23/46 (50%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query: 110 VLVLSKANFET-VITTTEYILVEFYAPWCGHCKSLAPEYAKAATKL 244
           V+VL+ +NF+  V+ + E  +VEF+APWCGHC+ L PE+ KAA ++
Sbjct: 156 VVVLTDSNFDKLVLNSKEPWMVEFFAPWCGHCQKLEPEWKKAAEEM 201



 Score = 54.8 bits (126), Expect = 8e-08
 Identities = 29/91 (31%), Positives = 47/91 (51%), Gaps = 10/91 (10%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPI-----DYSGGRQADDIISWLKKK-- 420
           +K   +DAT  + +A+ +G+RG+PT+KFF  G+       DY GGR + D+IS+ + K  
Sbjct: 205 VKFGALDATAHESIAQKFGIRGFPTIKFFAPGTSSASDAEDYQGGRTSTDLISYAESKYD 264

Query: 421 ---TGPPAVEVTSAEQAKELIDANTVIVFGF 504
                P  VE T     + +     + +F F
Sbjct: 265 DFGAAPEVVEGTGKAVVETVCKDKQLCIFTF 295



 Score = 46.0 bits (104), Expect = 4e-05
 Identities = 27/83 (32%), Positives = 44/83 (53%), Gaps = 6/83 (7%)
 Frame = +1

Query: 265 KLAKVDATQEQDLAESYGVRGYPTLKFF---RNGSPIDYSGGRQADDIISWLKK---KTG 426
           ++  +DAT  Q +   Y ++GYPT+K F       PIDY+G R A  I   +KK   K+ 
Sbjct: 76  EIGAIDATVHQKIPLKYSIKGYPTIKIFGATEKSKPIDYNGPRTAKGIADAVKKSIEKSL 135

Query: 427 PPAVEVTSAEQAKELIDANTVIV 495
              ++  S+E++K+      V+V
Sbjct: 136 EQRLKGKSSEKSKKSDKKGKVVV 158


>AC084197-8|AAG23476.1|  228|Caenorhabditis elegans Hypothetical
           protein Y73B6BL.12 protein.
          Length = 228

 Score = 48.4 bits (110), Expect = 7e-06
 Identities = 23/52 (44%), Positives = 33/52 (63%)
 Frame = +2

Query: 92  VPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLA 247
           +PTE  V+ L      TV+ ++E  +V+F+APWCGHC   AP Y + A +LA
Sbjct: 108 LPTE--VVSLGNDFHTTVLDSSEPWIVDFFAPWCGHCIQFAPIYDRIAKELA 157


>AL032657-16|CAJ85780.1|  318|Caenorhabditis elegans Hypothetical
           protein Y47H9C.5b protein.
          Length = 318

 Score = 48.0 bits (109), Expect = 9e-06
 Identities = 23/53 (43%), Positives = 33/53 (62%), Gaps = 3/53 (5%)
 Frame = +2

Query: 107 NVLVLSKANFETVITTT---EYILVEFYAPWCGHCKSLAPEYAKAATKLAEED 256
           +V+ +S   FE ++      E  LV+F+APWCG C+ LAPE  KAA ++A  D
Sbjct: 80  SVMEMSPEQFEELVMNRKDEETWLVDFFAPWCGPCQQLAPELQKAARQIAAFD 132



 Score = 48.0 bits (109), Expect = 9e-06
 Identities = 23/52 (44%), Positives = 33/52 (63%)
 Frame = +2

Query: 92  VPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLA 247
           +PTE  V+ L      TV+ ++E  +V+F+APWCGHC   AP Y + A +LA
Sbjct: 198 LPTE--VVSLGNDFHTTVLDSSEPWIVDFFAPWCGHCIQFAPIYDQIAKELA 247


>AL032657-15|CAA21734.1|  788|Caenorhabditis elegans Hypothetical
           protein Y47H9C.5a protein.
          Length = 788

 Score = 48.0 bits (109), Expect = 9e-06
 Identities = 23/53 (43%), Positives = 33/53 (62%), Gaps = 3/53 (5%)
 Frame = +2

Query: 107 NVLVLSKANFETVITTT---EYILVEFYAPWCGHCKSLAPEYAKAATKLAEED 256
           +V+ +S   FE ++      E  LV+F+APWCG C+ LAPE  KAA ++A  D
Sbjct: 550 SVMEMSPEQFEELVMNRKDEETWLVDFFAPWCGPCQQLAPELQKAARQIAAFD 602



 Score = 48.0 bits (109), Expect = 9e-06
 Identities = 23/52 (44%), Positives = 33/52 (63%)
 Frame = +2

Query: 92  VPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLA 247
           +PTE  V+ L      TV+ ++E  +V+F+APWCGHC   AP Y + A +LA
Sbjct: 668 LPTE--VVSLGNDFHTTVLDSSEPWIVDFFAPWCGHCIQFAPIYDQIAKELA 717



 Score = 45.2 bits (102), Expect = 6e-05
 Identities = 16/55 (29%), Positives = 35/55 (63%)
 Frame = +2

Query: 98  TEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEDLL 262
           ++ ++ VL++ ++E  I+  E+ +++++APWC  C  L  EY +  T  +E+ +L
Sbjct: 436 SKSHIHVLNRDSYEYAISGGEFYIIDYFAPWCPPCMKLLGEYRRFHTATSEDSML 490



 Score = 40.3 bits (90), Expect = 0.002
 Identities = 14/49 (28%), Positives = 32/49 (65%), Gaps = 1/49 (2%)
 Frame = +2

Query: 101 EENVLVLSKANFETVITTTEYI-LVEFYAPWCGHCKSLAPEYAKAATKL 244
           ++ ++ L++A+F+ +++ +  I  + FY+ +C HC  LAP + K A ++
Sbjct: 115 DQEIVTLNRADFQRMVSDSNEIWFINFYSTYCSHCHQLAPTWRKFAREI 163


>Z69637-1|CAA93467.1|  601|Caenorhabditis elegans Hypothetical
           protein F35G2.1a protein.
          Length = 601

 Score = 46.4 bits (105), Expect = 3e-05
 Identities = 18/52 (34%), Positives = 29/52 (55%)
 Frame = +2

Query: 95  PTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAE 250
           P  E ++ L +  F   + +    LVEFYA WCGHC++ AP + + A  + +
Sbjct: 48  PGFEPIMHLDQMTFNDTVFSDRAFLVEFYADWCGHCRAFAPYFRQFANMVRD 99


>U80848-2|AAB37989.1|  574|Caenorhabditis elegans Hypothetical
           protein T10H10.2 protein.
          Length = 574

 Score = 44.8 bits (101), Expect = 8e-05
 Identities = 21/49 (42%), Positives = 28/49 (57%), Gaps = 4/49 (8%)
 Frame = +2

Query: 101 EENVLVLSKANFETVITTTEY----ILVEFYAPWCGHCKSLAPEYAKAA 235
           E++VL L +A F   I   +      LVEFY+ WCGHC++ AP Y   A
Sbjct: 33  EDSVLQLDEATFNDTIFGAQSGAAGYLVEFYSDWCGHCRAFAPTYKNLA 81


>U23168-6|AAP86623.1|  114|Caenorhabditis elegans Hypothetical
           protein B0228.5b protein.
          Length = 114

 Score = 43.2 bits (97), Expect = 3e-04
 Identities = 21/50 (42%), Positives = 34/50 (68%), Gaps = 3/50 (6%)
 Frame = +2

Query: 98  TEENVLVLSK-ANFETVITT--TEYILVEFYAPWCGHCKSLAPEYAKAAT 238
           T+E +L L+  ++FE +I     + I+++FYA WCG CK++AP Y + AT
Sbjct: 4   TKEPILELADMSDFEQLIRQHPEKIIILDFYATWCGPCKAIAPLYKELAT 53



 Score = 33.1 bits (72), Expect = 0.27
 Identities = 16/46 (34%), Positives = 23/46 (50%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDI 399
           I   KVD  + +DL   Y V+  PT  F +NG  I+   G   D++
Sbjct: 58  IIFCKVDVDEAEDLCSKYDVKMMPTFIFTKNGDAIEALEGCVEDEL 103


>DQ241300-1|ABB45864.1|  114|Caenorhabditis elegans TRX-1b protein.
          Length = 114

 Score = 43.2 bits (97), Expect = 3e-04
 Identities = 21/50 (42%), Positives = 34/50 (68%), Gaps = 3/50 (6%)
 Frame = +2

Query: 98  TEENVLVLSK-ANFETVITT--TEYILVEFYAPWCGHCKSLAPEYAKAAT 238
           T+E +L L+  ++FE +I     + I+++FYA WCG CK++AP Y + AT
Sbjct: 4   TKEPILELADMSDFEQLIRQHPEKIIILDFYATWCGPCKAIAPLYKELAT 53



 Score = 33.1 bits (72), Expect = 0.27
 Identities = 16/46 (34%), Positives = 23/46 (50%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDI 399
           I   KVD  + +DL   Y V+  PT  F +NG  I+   G   D++
Sbjct: 58  IIFCKVDVDEAEDLCSKYDVKMMPTFIFTKNGDAIEALEGCVEDEL 103


>U97402-2|AAB63409.2|  393|Caenorhabditis elegans Hypothetical
           protein C30H7.2a protein.
          Length = 393

 Score = 42.3 bits (95), Expect = 4e-04
 Identities = 21/55 (38%), Positives = 29/55 (52%), Gaps = 2/55 (3%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPI--DYSGGRQADDIISWLKKK 420
           I  A VDA +  D+A  Y V  YPTLK FRNG     +Y   R  + +  ++ K+
Sbjct: 71  IMWASVDADKNNDIATKYHVNKYPTLKLFRNGEAAKREYRSSRSVEALSEFINKQ 125



 Score = 39.9 bits (89), Expect = 0.002
 Identities = 17/47 (36%), Positives = 25/47 (53%)
 Frame = +2

Query: 110 VLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAE 250
           V+ L+  NFE  I   E + V FYA WC   + L P + +A+ K  +
Sbjct: 19  VVSLTSQNFEQTIQANELVFVNFYADWCRFSQMLKPIFLEASEKFKD 65


>U97402-1|ABB51193.1|  393|Caenorhabditis elegans Hypothetical
           protein C30H7.2b protein.
          Length = 393

 Score = 42.3 bits (95), Expect = 4e-04
 Identities = 21/55 (38%), Positives = 29/55 (52%), Gaps = 2/55 (3%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPI--DYSGGRQADDIISWLKKK 420
           I  A VDA +  D+A  Y V  YPTLK FRNG     +Y   R  + +  ++ K+
Sbjct: 71  IMWASVDADKNNDIATKYHVNKYPTLKLFRNGEAAKREYRSSRSVEALSEFINKQ 125



 Score = 39.9 bits (89), Expect = 0.002
 Identities = 17/47 (36%), Positives = 25/47 (53%)
 Frame = +2

Query: 110 VLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAE 250
           V+ L+  NFE  I   E + V FYA WC   + L P + +A+ K  +
Sbjct: 19  VVSLTSQNFEQTIQANELVFVNFYADWCRFSQMLKPIFLEASEKFKD 65


>U23168-7|AAC38808.1|  115|Caenorhabditis elegans Hypothetical
           protein B0228.5a protein.
          Length = 115

 Score = 41.1 bits (92), Expect = 0.001
 Identities = 18/47 (38%), Positives = 31/47 (65%), Gaps = 2/47 (4%)
 Frame = +2

Query: 104 ENVLVLSKANFETVITT--TEYILVEFYAPWCGHCKSLAPEYAKAAT 238
           +N +   +++FE +I     + I+++FYA WCG CK++AP Y + AT
Sbjct: 8   KNQVKYFQSDFEQLIRQHPEKIIILDFYATWCGPCKAIAPLYKELAT 54



 Score = 33.1 bits (72), Expect = 0.27
 Identities = 16/46 (34%), Positives = 23/46 (50%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDI 399
           I   KVD  + +DL   Y V+  PT  F +NG  I+   G   D++
Sbjct: 59  IIFCKVDVDEAEDLCSKYDVKMMPTFIFTKNGDAIEALEGCVEDEL 104


>DQ241299-1|ABB45863.1|  115|Caenorhabditis elegans TRX-1a protein.
          Length = 115

 Score = 41.1 bits (92), Expect = 0.001
 Identities = 18/47 (38%), Positives = 31/47 (65%), Gaps = 2/47 (4%)
 Frame = +2

Query: 104 ENVLVLSKANFETVITT--TEYILVEFYAPWCGHCKSLAPEYAKAAT 238
           +N +   +++FE +I     + I+++FYA WCG CK++AP Y + AT
Sbjct: 8   KNQVKYFQSDFEQLIRQHPEKIIILDFYATWCGPCKAIAPLYKELAT 54



 Score = 33.1 bits (72), Expect = 0.27
 Identities = 16/46 (34%), Positives = 23/46 (50%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDI 399
           I   KVD  + +DL   Y V+  PT  F +NG  I+   G   D++
Sbjct: 59  IIFCKVDVDEAEDLCSKYDVKMMPTFIFTKNGDAIEALEGCVEDEL 104


>U41012-4|AAA82296.2|  413|Caenorhabditis elegans Hypothetical
           protein C06A6.5 protein.
          Length = 413

 Score = 39.5 bits (88), Expect = 0.003
 Identities = 21/71 (29%), Positives = 38/71 (53%), Gaps = 2/71 (2%)
 Frame = +1

Query: 271 AKVDATQEQDLAESYGVRGYPTLKFFRNGSPI--DYSGGRQADDIISWLKKKTGPPAVEV 444
           A VD+ ++ D+ + Y V  YPT+K F NG  I  +Y   R  + + +++K +      E 
Sbjct: 83  AIVDSQRQADIGDKYFVNKYPTMKVFVNGELITKEYRSTRSVEALTNFVKFQLSTAINEF 142

Query: 445 TSAEQAKELID 477
           +S +Q  + +D
Sbjct: 143 SSQDQLNQEMD 153


>Z69792-2|CAA93667.1|  417|Caenorhabditis elegans Hypothetical
           protein F40E10.3 protein.
          Length = 417

 Score = 37.5 bits (83), Expect = 0.013
 Identities = 21/80 (26%), Positives = 38/80 (47%), Gaps = 3/80 (3%)
 Frame = +1

Query: 277 VDATQEQDLAESYGV-RGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAVEVTSA 453
           V+ T+E  L +   V +G  T+  +++G  I+Y+G R  +  +SWL      P   +   
Sbjct: 101 VNTTKEHRLRKQEEVEKGEDTIHVYKDGYKIEYNGVRDPETFVSWLMDIPDDPVTIINDE 160

Query: 454 EQAKEL--IDANTVIVFGFF 507
              +E   +D   V + G+F
Sbjct: 161 HDLEEFENMDDECVRIIGYF 180



 Score = 29.5 bits (63), Expect = 3.4
 Identities = 19/62 (30%), Positives = 31/62 (50%), Gaps = 2/62 (3%)
 Frame = +3

Query: 531 KTFLSTAQVVDDQVFAIVSDEKVIKELE-AEDEDVVLFKNFEEKRVKYXD-EEITEDLLN 704
           +TF+S    + D    I++DE  ++E E  +DE V +   FE   V   + EE  ED + 
Sbjct: 140 ETFVSWLMDIPDDPVTIINDEHDLEEFENMDDECVRIIGYFEPGSVALKEFEEAAEDFMG 199

Query: 705 AL 710
            +
Sbjct: 200 EI 201


>U39646-7|AAA80371.1|  623|Caenorhabditis elegans Hypothetical
           protein F47B7.2a protein.
          Length = 623

 Score = 36.3 bits (80), Expect = 0.029
 Identities = 22/69 (31%), Positives = 35/69 (50%), Gaps = 1/69 (1%)
 Frame = +2

Query: 41  VLIFTAIALLGLALGDEVPTEENVLVLSKANFETVITTTEYI-LVEFYAPWCGHCKSLAP 217
           +L F+A    G +L D+   ++ +L L    F   I  ++    +EFY+ WCG C   AP
Sbjct: 30  ILAFSAGGSSGESLYDK---DDPILELDVDTFSAAIYGSKKAHFIEFYSSWCGACIGYAP 86

Query: 218 EYAKAATKL 244
            + K A +L
Sbjct: 87  TFKKFAKQL 95


>U39646-6|AAK72058.1|  624|Caenorhabditis elegans Hypothetical
           protein F47B7.2c protein.
          Length = 624

 Score = 36.3 bits (80), Expect = 0.029
 Identities = 22/69 (31%), Positives = 35/69 (50%), Gaps = 1/69 (1%)
 Frame = +2

Query: 41  VLIFTAIALLGLALGDEVPTEENVLVLSKANFETVITTTEYI-LVEFYAPWCGHCKSLAP 217
           +L F+A    G +L D+   ++ +L L    F   I  ++    +EFY+ WCG C   AP
Sbjct: 30  ILAFSAGGSSGESLYDK---DDPILELDVDTFSAAIYGSKKAHFIEFYSSWCGACIGYAP 86

Query: 218 EYAKAATKL 244
            + K A +L
Sbjct: 87  TFKKFAKQL 95


>U39646-5|AAK72057.1|  678|Caenorhabditis elegans Hypothetical
           protein F47B7.2b protein.
          Length = 678

 Score = 36.3 bits (80), Expect = 0.029
 Identities = 22/69 (31%), Positives = 35/69 (50%), Gaps = 1/69 (1%)
 Frame = +2

Query: 41  VLIFTAIALLGLALGDEVPTEENVLVLSKANFETVITTTEYI-LVEFYAPWCGHCKSLAP 217
           +L F+A    G +L D+   ++ +L L    F   I  ++    +EFY+ WCG C   AP
Sbjct: 30  ILAFSAGGSSGESLYDK---DDPILELDVDTFSAAIYGSKKAHFIEFYSSWCGACIGYAP 86

Query: 218 EYAKAATKL 244
            + K A +L
Sbjct: 87  TFKKFAKQL 95


>Z71178-7|CAA94881.1|  119|Caenorhabditis elegans Hypothetical
           protein B0024.9 protein.
          Length = 119

 Score = 35.9 bits (79), Expect = 0.039
 Identities = 21/59 (35%), Positives = 30/59 (50%), Gaps = 4/59 (6%)
 Frame = +1

Query: 238 KAG*RRSPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPID-YSG---GRQADDII 402
           K   R+  + LAK++     +LA  YG+   PT+  F+NG  I  +SG     Q DD I
Sbjct: 55  KVNGRQGSVLLAKINVDHAGELAMDYGISAVPTVFAFKNGEKISGFSGVLDDEQLDDFI 113



 Score = 34.7 bits (76), Expect = 0.090
 Identities = 12/27 (44%), Positives = 20/27 (74%)
 Frame = +2

Query: 137 ETVITTTEYILVEFYAPWCGHCKSLAP 217
           E VI ++  ++V+F+A WCG C++L P
Sbjct: 24  EKVIQSSVPVIVDFHAEWCGPCQALGP 50


>AF250045-1|AAG17620.1|  246|Caenorhabditis elegans thioredoxin-like
           protein DPY-11 protein.
          Length = 246

 Score = 35.5 bits (78), Expect = 0.051
 Identities = 18/53 (33%), Positives = 29/53 (54%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKK 420
           IK+ +VD T    L+  + V   PT+   ++G    YSG R  +D IS+++ K
Sbjct: 73  IKVGEVDVTVNPGLSGRFLVTALPTIYHVKDGVFRQYSGARDKNDFISFVEDK 125



 Score = 34.7 bits (76), Expect = 0.090
 Identities = 21/58 (36%), Positives = 32/58 (55%), Gaps = 2/58 (3%)
 Frame = +2

Query: 44  LIFTAIALLGL-ALG-DEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSL 211
           ++   +A+LGL A+G    PT  + LV       T +   E+ ++EF+APWC  CK L
Sbjct: 1   MLLRLLAVLGLFAVGVSGGPTRSSKLVFLNEENWTDLMKGEW-MIEFHAPWCPACKDL 57


>AF125955-2|AAD14719.1|  246|Caenorhabditis elegans Dumpy : shorter
           than wild-typeprotein 11 protein.
          Length = 246

 Score = 35.5 bits (78), Expect = 0.051
 Identities = 18/53 (33%), Positives = 29/53 (54%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKK 420
           IK+ +VD T    L+  + V   PT+   ++G    YSG R  +D IS+++ K
Sbjct: 73  IKVGEVDVTVNPGLSGRFLVTALPTIYHVKDGVFRQYSGARDKNDFISFVEDK 125



 Score = 34.7 bits (76), Expect = 0.090
 Identities = 21/58 (36%), Positives = 32/58 (55%), Gaps = 2/58 (3%)
 Frame = +2

Query: 44  LIFTAIALLGL-ALG-DEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSL 211
           ++   +A+LGL A+G    PT  + LV       T +   E+ ++EF+APWC  CK L
Sbjct: 1   MLLRLLAVLGLFAVGVSGGPTRSSKLVFLNEENWTDLMKGEW-MIEFHAPWCPACKDL 57


>U88167-3|AAB42224.2|  363|Caenorhabditis elegans Hypothetical
           protein D2092.4 protein.
          Length = 363

 Score = 33.9 bits (74), Expect = 0.16
 Identities = 13/48 (27%), Positives = 29/48 (60%), Gaps = 1/48 (2%)
 Frame = +1

Query: 274 KVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGG-RQADDIISWLK 414
           +V  T ++ +A   G+  +P+L ++R  +PI Y G  + ++ ++ WL+
Sbjct: 131 QVVKTNDRSVARELGINVFPSLVYYRRKNPILYDGDFKDSETLLRWLR 178


>AL110477-15|CAB54331.2|  295|Caenorhabditis elegans Hypothetical
           protein Y113G7B.9 protein.
          Length = 295

 Score = 33.9 bits (74), Expect = 0.16
 Identities = 16/62 (25%), Positives = 34/62 (54%)
 Frame = +2

Query: 41  VLIFTAIALLGLALGDEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPE 220
           +++F+ I  + L + + V  +++   +SKAN   ++ T   +L +F   +CGH    AP 
Sbjct: 184 IVLFSLILSIKLLMMNSVKHQQSNNQISKANRLALLDTCTVLLFDFLPAFCGHMWPTAPM 243

Query: 221 YA 226
           ++
Sbjct: 244 FS 245


>Z81044-3|CAB02808.1|  178|Caenorhabditis elegans Hypothetical
           protein C30H6.8 protein.
          Length = 178

 Score = 32.7 bits (71), Expect = 0.36
 Identities = 14/35 (40%), Positives = 18/35 (51%)
 Frame = +2

Query: 164 ILVEFYAPWCGHCKSLAPEYAKAATKLAEEDLLSN 268
           ++V F A WCG CK L P+  K    + E D   N
Sbjct: 54  VVVYFSAGWCGSCKFLTPKIKKFYNAVKESDAGKN 88


>AF143900-1|AAF66677.1|  284|Caenorhabditis elegans thioredoxin-like
           protein protein.
          Length = 284

 Score = 31.9 bits (69), Expect = 0.63
 Identities = 10/20 (50%), Positives = 15/20 (75%)
 Frame = +2

Query: 164 ILVEFYAPWCGHCKSLAPEY 223
           ++V+F A WCG CK +AP +
Sbjct: 24  VIVDFTAVWCGPCKMIAPTF 43


>AF143405-1|AAF66636.1|  284|Caenorhabditis elegans thioredoxin-like
           protein TXL protein.
          Length = 284

 Score = 31.9 bits (69), Expect = 0.63
 Identities = 10/20 (50%), Positives = 15/20 (75%)
 Frame = +2

Query: 164 ILVEFYAPWCGHCKSLAPEY 223
           ++V+F A WCG CK +AP +
Sbjct: 24  VIVDFTAVWCGPCKMIAPTF 43


>AC024810-17|AAF60759.1|  284|Caenorhabditis elegans Hypothetical
           protein Y54E10A.3 protein.
          Length = 284

 Score = 31.9 bits (69), Expect = 0.63
 Identities = 10/20 (50%), Positives = 15/20 (75%)
 Frame = +2

Query: 164 ILVEFYAPWCGHCKSLAPEY 223
           ++V+F A WCG CK +AP +
Sbjct: 24  VIVDFTAVWCGPCKMIAPTF 43


>U50135-4|AAA93455.3| 1487|Caenorhabditis elegans Hypothetical
           protein C52E12.4 protein.
          Length = 1487

 Score = 31.5 bits (68), Expect = 0.84
 Identities = 19/47 (40%), Positives = 26/47 (55%)
 Frame = +3

Query: 501 FLLDQSSARAKTFLSTAQVVDDQVFAIVSDEKVIKELEAEDEDVVLF 641
           FL DQ  +   TFL  A  ++ Q+F    D K++ + E  DE VVLF
Sbjct: 586 FLSDQPDSHL-TFL--AAFLETQMFTSFIDSKILSQWETPDEGVVLF 629


>Z81552-7|CAB04487.2|  606|Caenorhabditis elegans Hypothetical
           protein F56G4.5 protein.
          Length = 606

 Score = 31.1 bits (67), Expect = 1.1
 Identities = 9/33 (27%), Positives = 20/33 (60%)
 Frame = +2

Query: 164 ILVEFYAPWCGHCKSLAPEYAKAATKLAEEDLL 262
           I+++F+A WCG C+ ++P + + + +      L
Sbjct: 25  IIIDFFANWCGPCRMISPIFEQFSAEYGNATFL 57


>AL117201-5|CAB57916.1|  606|Caenorhabditis elegans Hypothetical
           protein F56G4.5 protein.
          Length = 606

 Score = 31.1 bits (67), Expect = 1.1
 Identities = 9/33 (27%), Positives = 20/33 (60%)
 Frame = +2

Query: 164 ILVEFYAPWCGHCKSLAPEYAKAATKLAEEDLL 262
           I+++F+A WCG C+ ++P + + + +      L
Sbjct: 25  IIIDFFANWCGPCRMISPIFEQFSAEYGNATFL 57


>AF125951-5|AAL27238.1|  345|Caenorhabditis elegans Hypothetical
           protein D2063.3a protein.
          Length = 345

 Score = 30.3 bits (65), Expect = 1.9
 Identities = 13/41 (31%), Positives = 22/41 (53%)
 Frame = +1

Query: 259 PIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGG 381
           P++ A +DA     ++ ++ +   PTL FF NG  +D   G
Sbjct: 51  PLRAAFIDAEALPGISLNFKITAAPTLVFFSNGKEVDRIDG 91


>AF125951-4|AAT68898.1|  342|Caenorhabditis elegans Hypothetical
           protein D2063.3b protein.
          Length = 342

 Score = 30.3 bits (65), Expect = 1.9
 Identities = 13/41 (31%), Positives = 22/41 (53%)
 Frame = +1

Query: 259 PIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGG 381
           P++ A +DA     ++ ++ +   PTL FF NG  +D   G
Sbjct: 51  PLRAAFIDAEALPGISLNFKITAAPTLVFFSNGKEVDRIDG 91


>AC024827-2|AAF60805.2|  254|Caenorhabditis elegans Hypothetical
           protein Y55F3AR.2 protein.
          Length = 254

 Score = 30.3 bits (65), Expect = 1.9
 Identities = 10/26 (38%), Positives = 17/26 (65%)
 Frame = +2

Query: 164 ILVEFYAPWCGHCKSLAPEYAKAATK 241
           + V+F A WCG C+ +AP ++  A +
Sbjct: 24  VFVDFTASWCGPCQYIAPIFSDLANQ 49


>AF016415-9|AAW88416.1|  297|Caenorhabditis elegans Serpentine
           receptor, class bc (class b-like) protein 36 protein.
          Length = 297

 Score = 29.9 bits (64), Expect = 2.6
 Identities = 16/62 (25%), Positives = 33/62 (53%)
 Frame = +2

Query: 41  VLIFTAIALLGLALGDEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPE 220
           ++IF+ +  + L + + V  ++N   LSKAN   ++     +L +F   +CG+    AP 
Sbjct: 184 IVIFSIMLSIRLFIWNMVKNKKNKNNLSKANRLALLDMCTVLLFDFLPSFCGNMWPTAPI 243

Query: 221 YA 226
           ++
Sbjct: 244 FS 245


>Z70686-12|CAB54289.1| 2584|Caenorhabditis elegans Hypothetical
            protein R11A8.7b protein.
          Length = 2584

 Score = 29.5 bits (63), Expect = 3.4
 Identities = 14/59 (23%), Positives = 31/59 (52%)
 Frame = +3

Query: 507  LDQSSARAKTFLSTAQVVDDQVFAIVSDEKVIKELEAEDEDVVLFKNFEEKRVKYXDEE 683
            +D   +  K    +A++   ++  ++ +EKV KE++ + +     K  EEK++K  + E
Sbjct: 1576 IDIIRSAKKAQAESAELAAQKLLELIDEEKVQKEVKKQKQKDKKIKKKEEKKIKKQEAE 1634


>Z70686-11|CAA94615.1| 2606|Caenorhabditis elegans Hypothetical
            protein R11A8.7a protein.
          Length = 2606

 Score = 29.5 bits (63), Expect = 3.4
 Identities = 14/59 (23%), Positives = 31/59 (52%)
 Frame = +3

Query: 507  LDQSSARAKTFLSTAQVVDDQVFAIVSDEKVIKELEAEDEDVVLFKNFEEKRVKYXDEE 683
            +D   +  K    +A++   ++  ++ +EKV KE++ + +     K  EEK++K  + E
Sbjct: 1576 IDIIRSAKKAQAESAELAAQKLLELIDEEKVQKEVKKQKQKDKKIKKKEEKKIKKQEAE 1634


>Z70686-8|CAM35837.1| 1427|Caenorhabditis elegans Hypothetical
           protein R11A8.7d protein.
          Length = 1427

 Score = 29.5 bits (63), Expect = 3.4
 Identities = 14/59 (23%), Positives = 31/59 (52%)
 Frame = +3

Query: 507 LDQSSARAKTFLSTAQVVDDQVFAIVSDEKVIKELEAEDEDVVLFKNFEEKRVKYXDEE 683
           +D   +  K    +A++   ++  ++ +EKV KE++ + +     K  EEK++K  + E
Sbjct: 397 IDIIRSAKKAQAESAELAAQKLLELIDEEKVQKEVKKQKQKDKKIKKKEEKKIKKQEAE 455


>Z70686-7|CAM35836.1| 1405|Caenorhabditis elegans Hypothetical
           protein R11A8.7c protein.
          Length = 1405

 Score = 29.5 bits (63), Expect = 3.4
 Identities = 14/59 (23%), Positives = 31/59 (52%)
 Frame = +3

Query: 507 LDQSSARAKTFLSTAQVVDDQVFAIVSDEKVIKELEAEDEDVVLFKNFEEKRVKYXDEE 683
           +D   +  K    +A++   ++  ++ +EKV KE++ + +     K  EEK++K  + E
Sbjct: 397 IDIIRSAKKAQAESAELAAQKLLELIDEEKVQKEVKKQKQKDKKIKKKEEKKIKKQEAE 455


>Z70310-9|CAB54294.1| 2584|Caenorhabditis elegans Hypothetical protein
            R11A8.7b protein.
          Length = 2584

 Score = 29.5 bits (63), Expect = 3.4
 Identities = 14/59 (23%), Positives = 31/59 (52%)
 Frame = +3

Query: 507  LDQSSARAKTFLSTAQVVDDQVFAIVSDEKVIKELEAEDEDVVLFKNFEEKRVKYXDEE 683
            +D   +  K    +A++   ++  ++ +EKV KE++ + +     K  EEK++K  + E
Sbjct: 1576 IDIIRSAKKAQAESAELAAQKLLELIDEEKVQKEVKKQKQKDKKIKKKEEKKIKKQEAE 1634


>Z70310-8|CAA94370.1| 2606|Caenorhabditis elegans Hypothetical protein
            R11A8.7a protein.
          Length = 2606

 Score = 29.5 bits (63), Expect = 3.4
 Identities = 14/59 (23%), Positives = 31/59 (52%)
 Frame = +3

Query: 507  LDQSSARAKTFLSTAQVVDDQVFAIVSDEKVIKELEAEDEDVVLFKNFEEKRVKYXDEE 683
            +D   +  K    +A++   ++  ++ +EKV KE++ + +     K  EEK++K  + E
Sbjct: 1576 IDIIRSAKKAQAESAELAAQKLLELIDEEKVQKEVKKQKQKDKKIKKKEEKKIKKQEAE 1634


>AF106589-2|AAC78230.1|  107|Caenorhabditis elegans Hypothetical
           protein Y44E3A.3 protein.
          Length = 107

 Score = 28.3 bits (60), Expect = 7.8
 Identities = 11/47 (23%), Positives = 24/47 (51%), Gaps = 2/47 (4%)
 Frame = +2

Query: 107 NVLVLSKANFETVITT--TEYILVEFYAPWCGHCKSLAPEYAKAATK 241
           ++ +     F+T+     T+ +++ F A WCG C+ + P   + A +
Sbjct: 2   SIAIKDDDEFKTIFAEKKTQPVILFFTASWCGPCQMIKPRVEELAAE 48


>AF039049-10|AAB94247.1|  548|Caenorhabditis elegans Cytochrome p450
           family protein 35B1 protein.
          Length = 548

 Score = 28.3 bits (60), Expect = 7.8
 Identities = 13/41 (31%), Positives = 22/41 (53%)
 Frame = +3

Query: 507 LDQSSARAKTFLSTAQVVDDQVFAIVSDEKVIKELEAEDED 629
           +D  +   KT + T +  D  V ++++   V K  EAED+D
Sbjct: 206 IDADAVNGKTIVHTTEFFDLTVGSVINSLLVGKRFEAEDKD 246


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 19,502,578
Number of Sequences: 27780
Number of extensions: 397017
Number of successful extensions: 1218
Number of sequences better than 10.0: 51
Number of HSP's better than 10.0 without gapping: 1077
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1212
length of database: 12,740,198
effective HSP length: 81
effective length of database: 10,490,018
effective search space used: 2255353870
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -