SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30165.Seq
         (897 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF024493-10|AAK68346.1|  232|Caenorhabditis elegans C. elegans N...    66   2e-11
AL132949-3|CAB61070.1|  179|Caenorhabditis elegans Hypothetical ...    50   2e-06
Z70753-7|CAD82914.1|  305|Caenorhabditis elegans Hypothetical pr...    31   0.85 
Z70753-6|CAA94762.1|  331|Caenorhabditis elegans Hypothetical pr...    31   0.85 
AL021487-5|CAA16350.1|  244|Caenorhabditis elegans Hypothetical ...    29   3.4  
AC024808-4|AAK29924.1|  252|Caenorhabditis elegans Hypothetical ...    29   6.0  
AL021487-4|CAA16351.1|  244|Caenorhabditis elegans Hypothetical ...    28   7.9  
AC024776-4|AAK68465.2|  155|Caenorhabditis elegans Hypothetical ...    28   7.9  

>AF024493-10|AAK68346.1|  232|Caenorhabditis elegans C. elegans
           NFYC-1 protein protein.
          Length = 232

 Score = 66.5 bits (155), Expect = 2e-11
 Identities = 29/82 (35%), Positives = 53/82 (64%), Gaps = 6/82 (7%)
 Frame = +1

Query: 289 QTLQQFWDKVLEDIQKVNSEDF----KTQALPLARIKKIMKLDEEVK--MISAEAPVLFA 450
           Q  + FW +  + + +++ ED     K  ++P+AR+KKIM++D++V+  MI+++AP+  A
Sbjct: 80  QMTEDFWREKKQKMTEISEEDMLNKSKNMSVPMARVKKIMRIDDDVRNFMIASDAPIFMA 139

Query: 451 KAAEIFIHELTLRAWSHTEEIK 516
           +AAE FI E+T   W +  E +
Sbjct: 140 QAAEFFIEEMTAMGWQYVSEAR 161



 Score = 30.7 bits (66), Expect = 1.5
 Identities = 13/25 (52%), Positives = 17/25 (68%)
 Frame = +2

Query: 542 SDSILKSDQFDFLIDIVPRHEVKPT 616
           + ++ KSDQFDFLID +P   V  T
Sbjct: 171 ASAVQKSDQFDFLIDFLPPKTVPTT 195


>AL132949-3|CAB61070.1|  179|Caenorhabditis elegans Hypothetical
           protein Y53F4B.3 protein.
          Length = 179

 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/56 (41%), Positives = 40/56 (71%), Gaps = 2/56 (3%)
 Frame = +1

Query: 322 EDIQKVNS--EDFKTQALPLARIKKIMKLDEEVKMISAEAPVLFAKAAEIFIHELT 483
           ED++++    E+     LPL R+KK+++++ +V+M++ EA  L AKAAE+FI EL+
Sbjct: 19  EDVREIEEHVEELVRSQLPLGRVKKVVRMNPDVEMLNNEALQLMAKAAELFIKELS 74


>Z70753-7|CAD82914.1|  305|Caenorhabditis elegans Hypothetical
           protein F40F9.7b protein.
          Length = 305

 Score = 31.5 bits (68), Expect = 0.85
 Identities = 16/52 (30%), Positives = 25/52 (48%)
 Frame = +1

Query: 352 FKTQALPLARIKKIMKLDEEVKMISAEAPVLFAKAAEIFIHELTLRAWSHTE 507
           F T  +   RIKK+M+ DE++  +    PV   +A E F  +    A   T+
Sbjct: 35  FSTAKIQPTRIKKVMQSDEDIGRMVQSVPVSIGRAMEHFAEKFLQAAAEATQ 86


>Z70753-6|CAA94762.1|  331|Caenorhabditis elegans Hypothetical
           protein F40F9.7a protein.
          Length = 331

 Score = 31.5 bits (68), Expect = 0.85
 Identities = 16/52 (30%), Positives = 25/52 (48%)
 Frame = +1

Query: 352 FKTQALPLARIKKIMKLDEEVKMISAEAPVLFAKAAEIFIHELTLRAWSHTE 507
           F T  +   RIKK+M+ DE++  +    PV   +A E F  +    A   T+
Sbjct: 61  FSTAKIQPTRIKKVMQSDEDIGRMVQSVPVSIGRAMEHFAEKFLQAAAEATQ 112


>AL021487-5|CAA16350.1|  244|Caenorhabditis elegans Hypothetical
           protein Y45F10B.9 protein.
          Length = 244

 Score = 29.5 bits (63), Expect = 3.4
 Identities = 20/74 (27%), Positives = 38/74 (51%), Gaps = 1/74 (1%)
 Frame = +1

Query: 313 KVL-EDIQKVNSEDFKTQALPLARIKKIMKLDEEVKMISAEAPVLFAKAAEIFIHELTLR 489
           K+L E++ K+ ++  KT+   +  +  +++ DE++K I  E  ++  + +  F  ELT  
Sbjct: 100 KILDEELDKLEAKISKTEESLVQSVSMLLEKDEQLKTIRKEMKIMDDERS-AFDQELTRL 158

Query: 490 AWSHTEEIKGGLCS 531
             S  E  K  L S
Sbjct: 159 KTSRLENEKSSLAS 172


>AC024808-4|AAK29924.1|  252|Caenorhabditis elegans Hypothetical
           protein Y53G8AM.7 protein.
          Length = 252

 Score = 28.7 bits (61), Expect = 6.0
 Identities = 11/21 (52%), Positives = 14/21 (66%)
 Frame = -1

Query: 144 PMFLFNYHSKLILKLCFGKLL 82
           PM +FN  S L + +CFG LL
Sbjct: 122 PMIIFNTSSALSISICFGNLL 142


>AL021487-4|CAA16351.1|  244|Caenorhabditis elegans Hypothetical
           protein Y45F10B.8 protein.
          Length = 244

 Score = 28.3 bits (60), Expect = 7.9
 Identities = 19/74 (25%), Positives = 38/74 (51%), Gaps = 1/74 (1%)
 Frame = +1

Query: 313 KVLED-IQKVNSEDFKTQALPLARIKKIMKLDEEVKMISAEAPVLFAKAAEIFIHELTLR 489
           K+L++ + K+ ++  KT+   +  +  +++ DE++K I  E  ++  + +  F  ELT  
Sbjct: 100 KILDEKLDKLEAKISKTEESLVQSVSMLLEKDEQLKTIRKEMKIMDDERS-AFDQELTRL 158

Query: 490 AWSHTEEIKGGLCS 531
             S  E  K  L S
Sbjct: 159 KTSRLENEKSSLAS 172


>AC024776-4|AAK68465.2|  155|Caenorhabditis elegans Hypothetical
           protein Y41D4B.15 protein.
          Length = 155

 Score = 28.3 bits (60), Expect = 7.9
 Identities = 17/53 (32%), Positives = 26/53 (49%), Gaps = 1/53 (1%)
 Frame = -3

Query: 163 TSRDKRTDVFIQLSLKINT*TMFW*ITLSSESNINT-VTNNQSIIWRSPIANY 8
           + RD  T VF+   LK+    ++     S  S + T  T++ SI W +P  NY
Sbjct: 42  SDRDDLTLVFLNQDLKMQNSQLYVPEMSSRVSGLETSATSSVSIYWNTPTENY 94


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 17,745,247
Number of Sequences: 27780
Number of extensions: 338543
Number of successful extensions: 879
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 845
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 878
length of database: 12,740,198
effective HSP length: 81
effective length of database: 10,490,018
effective search space used: 2276333906
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -