SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30164.Seq
         (888 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z49886-1|CAA90050.1|  809|Caenorhabditis elegans Hypothetical pr...   144   1e-34
Z48334-9|CAA88314.1|  810|Caenorhabditis elegans Hypothetical pr...   134   6e-32
Z48045-12|CAA88105.1|  810|Caenorhabditis elegans Hypothetical p...   134   6e-32
Z69904-3|CAA93780.1|  372|Caenorhabditis elegans Hypothetical pr...    29   5.9  
U88183-2|AAM69080.1| 1273|Caenorhabditis elegans Sensory axon gu...    29   5.9  
U88183-1|AAB52657.2| 1269|Caenorhabditis elegans Sensory axon gu...    29   5.9  
AF125450-3|AAD12817.1|  309|Caenorhabditis elegans Hypothetical ...    29   5.9  
AF041053-1|AAC38848.1| 1273|Caenorhabditis elegans SAX-3 protein.      29   5.9  

>Z49886-1|CAA90050.1|  809|Caenorhabditis elegans Hypothetical
           protein C06A1.1 protein.
          Length = 809

 Score =  144 bits (348), Expect = 1e-34
 Identities = 86/224 (38%), Positives = 130/224 (58%), Gaps = 2/224 (0%)
 Frame = +1

Query: 223 LAQGQTPQGNRCIVLSDDNCPDEKIRMXXXXXXXXXXXXSDVVSIAPCPSVKYGKRVHIL 402
           + +G+  + +  I++SD++CP+EK+RM             DVVSI P P++ YG R+H+L
Sbjct: 64  ILKGKKRKESVAIIVSDESCPNEKVRMNRVVRNNLRIRLGDVVSITPAPNLSYGTRIHVL 123

Query: 403 PIDDSVEGLTGNLFEVYLKPYFMEAYRPIHRDDTFRSAGACAPSSSKWSKQIHHHFASWL 582
           PIDD++EGLTGNLF+V+LKPYF+EAYRP+H+ D F    A      K  +       + +
Sbjct: 124 PIDDTIEGLTGNLFDVFLKPYFLEAYRPLHKGDIFTVQAAMRTVEFKVVET--EPAPACI 181

Query: 583 LIP*YTVTVNRLNVRKKRKH*MLSAMMTSAV--VANNWAQIKEMVELPLRSSFTVSRLLE 756
           + P   +      ++++ +   ++ +    +  V    AQIKEMVELPLR    + + + 
Sbjct: 182 VSPDTMIHYEGDPIKREEEEESMNDIGYDDLGGVRKQLAQIKEMVELPLRHP-QLFKAIG 240

Query: 757 *KLPRGILHVWGRLVTGKNTHWLVLLLMETGASSFLINGPGIMS 888
            K PRGIL ++G   TGK T     +  ETG+  FLINGP +MS
Sbjct: 241 IKPPRGIL-LFGPPGTGK-TLIARAVANETGSFFFLINGPEVMS 282



 Score =  111 bits (268), Expect = 5e-25
 Identities = 62/116 (53%), Positives = 76/116 (65%)
 Frame = +3

Query: 510 VRGGMRAVEFKVVETDPSPFCIVAPDTVIHCDGEPIKREEEEEALNAVGYDDIGGCRKQL 689
           V+  MR VEFKVVET+P+P CIV+PDT+IH +G+PIKREEEEE++N +GYDD+GG RKQL
Sbjct: 160 VQAAMRTVEFKVVETEPAPACIVSPDTMIHYEGDPIKREEEEESMNDIGYDDLGGVRKQL 219

Query: 690 GAN*GDGGVATAVILHCFKAIGVKASTRHSPCMGPPXNRKKHSLARAVANGNRGFF 857
            A   +           FKAIG+K   R     GPP   K   +ARAVAN    FF
Sbjct: 220 -AQIKEMVELPLRHPQLFKAIGIK-PPRGILLFGPPGTGKT-LIARAVANETGSFF 272



 Score = 90.6 bits (215), Expect = 1e-18
 Identities = 42/63 (66%), Positives = 55/63 (87%)
 Frame = +2

Query: 71  KSPDDLSTAILRRKDRPNRLIVEEAVSDDNSVVALSQAKMEQLQLFRGDTVLLKGKRRKE 250
           K  D+LSTAIL+ K +PNRLIV+++  DDNSV+A+SQAKM++L LFRGD V+LKGK+RKE
Sbjct: 13  KKNDELSTAILKDKVKPNRLIVDQSEQDDNSVIAVSQAKMDELGLFRGDAVILKGKKRKE 72

Query: 251 TVA 259
           +VA
Sbjct: 73  SVA 75


>Z48334-9|CAA88314.1|  810|Caenorhabditis elegans Hypothetical
           protein C41C4.8 protein.
          Length = 810

 Score =  134 bits (325), Expect = 6e-32
 Identities = 88/224 (39%), Positives = 127/224 (56%), Gaps = 2/224 (0%)
 Frame = +1

Query: 223 LAQGQTPQGNRCIVLSDDNCPDEKIRMXXXXXXXXXXXXSDVVSIAPCPSVKYGKRVHIL 402
           + +G+  +    IVL+ DNCP++KI+M             DVVSI+    ++YGKRVH+L
Sbjct: 64  ILKGKKRRETVSIVLNADNCPNDKIKMNKVVRNNLRSRLGDVVSISSA-QLEYGKRVHVL 122

Query: 403 PIDDSVEGLTGNLFEVYLKPYFMEAYRPIHRDDTFRSAGACAPSSSKWSKQIHHHFASWL 582
           PIDD++EGLTGNLF+V+L+PYF +AYRP+H+ D F    A      K  +       + +
Sbjct: 123 PIDDTIEGLTGNLFDVFLRPYFTDAYRPVHKGDIFTVQAAMRTVEFKVVET--DPAPACI 180

Query: 583 LIP*YTVTVNRLNVRKKRKH*MLSAMMTSAV--VANNWAQIKEMVELPLRSSFTVSRLLE 756
           + P   +      ++++ +   L+ +    +  V    AQIKEMVELPLR    + + + 
Sbjct: 181 VAPDTVIHYEGDPIKREEEEEALNEVGYDDLGGVRKQLAQIKEMVELPLRHP-QLFKAIG 239

Query: 757 *KLPRGILHVWGRLVTGKNTHWLVLLLMETGASSFLINGPGIMS 888
            K PRGIL ++G   TGK T     +  ETGA  FLINGP IMS
Sbjct: 240 VKPPRGIL-LFGPPGTGK-TLIARAVANETGAFFFLINGPEIMS 281



 Score =  119 bits (286), Expect = 3e-27
 Identities = 69/116 (59%), Positives = 76/116 (65%)
 Frame = +3

Query: 510 VRGGMRAVEFKVVETDPSPFCIVAPDTVIHCDGEPIKREEEEEALNAVGYDDIGGCRKQL 689
           V+  MR VEFKVVETDP+P CIVAPDTVIH +G+PIKREEEEEALN VGYDD+GG RKQL
Sbjct: 159 VQAAMRTVEFKVVETDPAPACIVAPDTVIHYEGDPIKREEEEEALNEVGYDDLGGVRKQL 218

Query: 690 GAN*GDGGVATAVILHCFKAIGVKASTRHSPCMGPPXNRKKHSLARAVANGNRGFF 857
            A   +           FKAIGVK   R     GPP   K   +ARAVAN    FF
Sbjct: 219 -AQIKEMVELPLRHPQLFKAIGVK-PPRGILLFGPPGTGKT-LIARAVANETGAFF 271



 Score = 89.0 bits (211), Expect = 4e-18
 Identities = 40/63 (63%), Positives = 56/63 (88%)
 Frame = +2

Query: 71  KSPDDLSTAILRRKDRPNRLIVEEAVSDDNSVVALSQAKMEQLQLFRGDTVLLKGKRRKE 250
           K  D+L+TAIL+ K RPNRLI++++ +DDNS+V LSQAKM++L LFRGD+V+LKGK+R+E
Sbjct: 13  KKNDELATAILKDKKRPNRLIIDQSDNDDNSMVMLSQAKMDELGLFRGDSVILKGKKRRE 72

Query: 251 TVA 259
           TV+
Sbjct: 73  TVS 75


>Z48045-12|CAA88105.1|  810|Caenorhabditis elegans Hypothetical
           protein C41C4.8 protein.
          Length = 810

 Score =  134 bits (325), Expect = 6e-32
 Identities = 88/224 (39%), Positives = 127/224 (56%), Gaps = 2/224 (0%)
 Frame = +1

Query: 223 LAQGQTPQGNRCIVLSDDNCPDEKIRMXXXXXXXXXXXXSDVVSIAPCPSVKYGKRVHIL 402
           + +G+  +    IVL+ DNCP++KI+M             DVVSI+    ++YGKRVH+L
Sbjct: 64  ILKGKKRRETVSIVLNADNCPNDKIKMNKVVRNNLRSRLGDVVSISSA-QLEYGKRVHVL 122

Query: 403 PIDDSVEGLTGNLFEVYLKPYFMEAYRPIHRDDTFRSAGACAPSSSKWSKQIHHHFASWL 582
           PIDD++EGLTGNLF+V+L+PYF +AYRP+H+ D F    A      K  +       + +
Sbjct: 123 PIDDTIEGLTGNLFDVFLRPYFTDAYRPVHKGDIFTVQAAMRTVEFKVVET--DPAPACI 180

Query: 583 LIP*YTVTVNRLNVRKKRKH*MLSAMMTSAV--VANNWAQIKEMVELPLRSSFTVSRLLE 756
           + P   +      ++++ +   L+ +    +  V    AQIKEMVELPLR    + + + 
Sbjct: 181 VAPDTVIHYEGDPIKREEEEEALNEVGYDDLGGVRKQLAQIKEMVELPLRHP-QLFKAIG 239

Query: 757 *KLPRGILHVWGRLVTGKNTHWLVLLLMETGASSFLINGPGIMS 888
            K PRGIL ++G   TGK T     +  ETGA  FLINGP IMS
Sbjct: 240 VKPPRGIL-LFGPPGTGK-TLIARAVANETGAFFFLINGPEIMS 281



 Score =  119 bits (286), Expect = 3e-27
 Identities = 69/116 (59%), Positives = 76/116 (65%)
 Frame = +3

Query: 510 VRGGMRAVEFKVVETDPSPFCIVAPDTVIHCDGEPIKREEEEEALNAVGYDDIGGCRKQL 689
           V+  MR VEFKVVETDP+P CIVAPDTVIH +G+PIKREEEEEALN VGYDD+GG RKQL
Sbjct: 159 VQAAMRTVEFKVVETDPAPACIVAPDTVIHYEGDPIKREEEEEALNEVGYDDLGGVRKQL 218

Query: 690 GAN*GDGGVATAVILHCFKAIGVKASTRHSPCMGPPXNRKKHSLARAVANGNRGFF 857
            A   +           FKAIGVK   R     GPP   K   +ARAVAN    FF
Sbjct: 219 -AQIKEMVELPLRHPQLFKAIGVK-PPRGILLFGPPGTGKT-LIARAVANETGAFF 271



 Score = 89.0 bits (211), Expect = 4e-18
 Identities = 40/63 (63%), Positives = 56/63 (88%)
 Frame = +2

Query: 71  KSPDDLSTAILRRKDRPNRLIVEEAVSDDNSVVALSQAKMEQLQLFRGDTVLLKGKRRKE 250
           K  D+L+TAIL+ K RPNRLI++++ +DDNS+V LSQAKM++L LFRGD+V+LKGK+R+E
Sbjct: 13  KKNDELATAILKDKKRPNRLIIDQSDNDDNSMVMLSQAKMDELGLFRGDSVILKGKKRRE 72

Query: 251 TVA 259
           TV+
Sbjct: 73  TVS 75


>Z69904-3|CAA93780.1|  372|Caenorhabditis elegans Hypothetical
           protein ZK20.3 protein.
          Length = 372

 Score = 28.7 bits (61), Expect = 5.9
 Identities = 13/39 (33%), Positives = 22/39 (56%), Gaps = 2/39 (5%)
 Frame = +3

Query: 552 TDPSPFCIVAPDTVIHCDGEPIKREEEEE--ALNAVGYD 662
           ++P+P   VAP+     + E +  E+EE   A+  +GYD
Sbjct: 153 SNPAPAADVAPEAAAPAEAEALTDEQEENVLAITGMGYD 191


>U88183-2|AAM69080.1| 1273|Caenorhabditis elegans Sensory axon
            guidance protein 3,isoform b protein.
          Length = 1273

 Score = 28.7 bits (61), Expect = 5.9
 Identities = 17/63 (26%), Positives = 31/63 (49%), Gaps = 1/63 (1%)
 Frame = +3

Query: 606  GEPIKREEEEEA-LNAVGYDDIGGCRKQLGAN*GDGGVATAVILHCFKAIGVKASTRHSP 782
            G P+K + ++++  +++  DD GG  +  G N  +G V    +      +G+ AST    
Sbjct: 1189 GRPLKGKRDDDSQRSSLMMDDDGGSSEADGEN-SEGDVPRGGVRKAVPRMGISASTLAHS 1247

Query: 783  CMG 791
            C G
Sbjct: 1248 CYG 1250


>U88183-1|AAB52657.2| 1269|Caenorhabditis elegans Sensory axon
            guidance protein 3,isoform a protein.
          Length = 1269

 Score = 28.7 bits (61), Expect = 5.9
 Identities = 17/63 (26%), Positives = 31/63 (49%), Gaps = 1/63 (1%)
 Frame = +3

Query: 606  GEPIKREEEEEA-LNAVGYDDIGGCRKQLGAN*GDGGVATAVILHCFKAIGVKASTRHSP 782
            G P+K + ++++  +++  DD GG  +  G N  +G V    +      +G+ AST    
Sbjct: 1185 GRPLKGKRDDDSQRSSLMMDDDGGSSEADGEN-SEGDVPRGGVRKAVPRMGISASTLAHS 1243

Query: 783  CMG 791
            C G
Sbjct: 1244 CYG 1246


>AF125450-3|AAD12817.1|  309|Caenorhabditis elegans Hypothetical
          protein Y39F10A.3 protein.
          Length = 309

 Score = 28.7 bits (61), Expect = 5.9
 Identities = 11/25 (44%), Positives = 18/25 (72%)
 Frame = -3

Query: 85 IIRAFIICHFIQNLLLESKNYYNFY 11
          ++ AF++C  + N+LL SK+ Y FY
Sbjct: 8  LLLAFVVCLTLFNVLLWSKSNYGFY 32


>AF041053-1|AAC38848.1| 1273|Caenorhabditis elegans SAX-3 protein.
          Length = 1273

 Score = 28.7 bits (61), Expect = 5.9
 Identities = 17/63 (26%), Positives = 31/63 (49%), Gaps = 1/63 (1%)
 Frame = +3

Query: 606  GEPIKREEEEEA-LNAVGYDDIGGCRKQLGAN*GDGGVATAVILHCFKAIGVKASTRHSP 782
            G P+K + ++++  +++  DD GG  +  G N  +G V    +      +G+ AST    
Sbjct: 1189 GRPLKGKRDDDSQRSSLMMDDDGGSSEADGEN-SEGDVPRGGVRKAVPRMGISASTLAHS 1247

Query: 783  CMG 791
            C G
Sbjct: 1248 CYG 1250


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 21,328,017
Number of Sequences: 27780
Number of extensions: 457728
Number of successful extensions: 1227
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 1130
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1219
length of database: 12,740,198
effective HSP length: 81
effective length of database: 10,490,018
effective search space used: 2244863852
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -