SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30163.Seq
         (824 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z81525-8|CAB04257.1|  208|Caenorhabditis elegans Hypothetical pr...    94   1e-19
U88173-8|AAK21380.1|  267|Caenorhabditis elegans C.elegans y-box...    65   7e-11
Z73424-7|CAA97783.1|  294|Caenorhabditis elegans Hypothetical pr...    62   4e-10
AL023839-3|CAA19509.1|  294|Caenorhabditis elegans Hypothetical ...    62   4e-10
U80450-3|AAB37828.1|  265|Caenorhabditis elegans C.elegans y-box...    61   8e-10
Z81494-3|CAB61009.1|  196|Caenorhabditis elegans Hypothetical pr...    36   0.047
Z81494-2|CAB61008.1|  227|Caenorhabditis elegans Hypothetical pr...    36   0.047
U75915-1|AAB49759.1|  227|Caenorhabditis elegans Lin-28 protein.       36   0.047
U75912-1|AAC47476.1|  227|Caenorhabditis elegans LIN-28 protein.       36   0.047
Z82278-10|CAC15860.2|  390|Caenorhabditis elegans Hypothetical p...    28   7.1  
AL132943-14|CAC14395.2|  390|Caenorhabditis elegans Hypothetical...    28   7.1  
U88166-3|AAO44910.1|  160|Caenorhabditis elegans Collagen protei...    28   9.3  
U23527-3|AAC46573.3|  596|Caenorhabditis elegans Hypothetical pr...    28   9.3  

>Z81525-8|CAB04257.1|  208|Caenorhabditis elegans Hypothetical
           protein F33A8.3 protein.
          Length = 208

 Score = 93.9 bits (223), Expect = 1e-19
 Identities = 43/69 (62%), Positives = 50/69 (72%)
 Frame = +1

Query: 241 FHQQDDTKEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPV 420
           F  + DT ED+FVHQTAI  NNP K +RS+GD E V F +V G KG EAA VTGP G PV
Sbjct: 36  FINRTDTNEDIFVHQTAIINNNPNKYLRSLGDNEEVMFDIVEGSKGLEAASVTGPDGGPV 95

Query: 421 KGSPYAADK 447
           +GS YAAD+
Sbjct: 96  QGSKYAADR 104



 Score = 46.8 bits (106), Expect = 2e-05
 Identities = 20/24 (83%), Positives = 21/24 (87%)
 Frame = +2

Query: 182 VIAEKVSGTVKWFNVKSGYGFINR 253
           V A KV GTVKWFNVK+GYGFINR
Sbjct: 16  VKATKVKGTVKWFNVKNGYGFINR 39


>U88173-8|AAK21380.1|  267|Caenorhabditis elegans C.elegans y-box
           protein 2 protein.
          Length = 267

 Score = 64.9 bits (151), Expect = 7e-11
 Identities = 35/81 (43%), Positives = 50/81 (61%), Gaps = 1/81 (1%)
 Frame = +1

Query: 241 FHQQDDTKEDVFVHQTAIARNNPRKA-VRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEP 417
           F  ++D ++D+FVHQTAIA++   K  +R++GD E V F +V G+ G EAA VTGP G+ 
Sbjct: 81  FISRNDGEKDIFVHQTAIAKSATEKFYLRTLGDDEEVLFDLVEGKNGPEAANVTGPNGDN 140

Query: 418 VKGSPYAADKRRGYHRQYFPR 480
           V GS Y       + +   PR
Sbjct: 141 VIGSRYRHKLLSRFRKNRKPR 161



 Score = 28.7 bits (61), Expect = 5.3
 Identities = 18/53 (33%), Positives = 25/53 (47%)
 Frame = +2

Query: 185 IAEKVSGTVKWFNVKSGYGFINRMTPRKMCLCIRLPSPVTTHVRLCARSATER 343
           I   + G VKW++V   YGFI+R    K          +  H    A+SATE+
Sbjct: 62  ITTGLQGKVKWYSVLRRYGFISRNDGEK---------DIFVHQTAIAKSATEK 105


>Z73424-7|CAA97783.1|  294|Caenorhabditis elegans Hypothetical
           protein Y39A1C.3 protein.
          Length = 294

 Score = 62.5 bits (145), Expect = 4e-10
 Identities = 33/62 (53%), Positives = 42/62 (67%), Gaps = 1/62 (1%)
 Frame = +1

Query: 256 DTKEDVFVHQTAIARNNPRKA-VRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPVKGSP 432
           D  ED FVHQTAI +++  K  +R++ D E V F +V G KG EAA VTGP GE V+GS 
Sbjct: 112 DENEDFFVHQTAITKSSTIKFYLRTLDDDEPVVFDIVEGLKGPEAANVTGPDGENVRGSR 171

Query: 433 YA 438
           +A
Sbjct: 172 FA 173



 Score = 32.7 bits (71), Expect = 0.33
 Identities = 14/27 (51%), Positives = 17/27 (62%)
 Frame = +2

Query: 182 VIAEKVSGTVKWFNVKSGYGFINRMTP 262
           VI   V G VKWF+V+  YGF+ R  P
Sbjct: 84  VIETGVKGHVKWFSVRGRYGFVARDKP 110


>AL023839-3|CAA19509.1|  294|Caenorhabditis elegans Hypothetical
           protein Y39A1C.3 protein.
          Length = 294

 Score = 62.5 bits (145), Expect = 4e-10
 Identities = 33/62 (53%), Positives = 42/62 (67%), Gaps = 1/62 (1%)
 Frame = +1

Query: 256 DTKEDVFVHQTAIARNNPRKA-VRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPVKGSP 432
           D  ED FVHQTAI +++  K  +R++ D E V F +V G KG EAA VTGP GE V+GS 
Sbjct: 112 DENEDFFVHQTAITKSSTIKFYLRTLDDDEPVVFDIVEGLKGPEAANVTGPDGENVRGSR 171

Query: 433 YA 438
           +A
Sbjct: 172 FA 173



 Score = 32.7 bits (71), Expect = 0.33
 Identities = 14/27 (51%), Positives = 17/27 (62%)
 Frame = +2

Query: 182 VIAEKVSGTVKWFNVKSGYGFINRMTP 262
           VI   V G VKWF+V+  YGF+ R  P
Sbjct: 84  VIETGVKGHVKWFSVRGRYGFVARDKP 110


>U80450-3|AAB37828.1|  265|Caenorhabditis elegans C.elegans y-box
           protein 3 protein.
          Length = 265

 Score = 61.3 bits (142), Expect = 8e-10
 Identities = 32/66 (48%), Positives = 44/66 (66%), Gaps = 1/66 (1%)
 Frame = +1

Query: 241 FHQQDDTKEDVFVHQTAIARNNPRKA-VRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEP 417
           F  + D ++DVFVHQTAI++++  K  +R++ D E V F +V G+ G EAA VTGP G  
Sbjct: 79  FISRSDGEKDVFVHQTAISKSDTEKFYLRTLADEEEVLFDLVDGKNGPEAANVTGPAGVN 138

Query: 418 VKGSPY 435
           V GS Y
Sbjct: 139 VSGSKY 144



 Score = 29.1 bits (62), Expect = 4.0
 Identities = 12/29 (41%), Positives = 17/29 (58%)
 Frame = +2

Query: 182 VIAEKVSGTVKWFNVKSGYGFINRMTPRK 268
           V+   + G VKW++V   YGFI+R    K
Sbjct: 59  VLTAGLQGKVKWYSVLRRYGFISRSDGEK 87


>Z81494-3|CAB61009.1|  196|Caenorhabditis elegans Hypothetical
           protein F02E9.2b protein.
          Length = 196

 Score = 35.5 bits (78), Expect = 0.047
 Identities = 27/79 (34%), Positives = 40/79 (50%), Gaps = 3/79 (3%)
 Frame = +1

Query: 202 GHCEMVQRQEWIWFHQQDDTKEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVV--AGEK 375
           G C+     +   F   D T ED+FVHQ+    N   +  RS+ +GE V + +   +  K
Sbjct: 24  GSCKWFNVSKGYGFVIDDITGEDLFVHQS----NLNMQGFRSLDEGERVSYYIQERSNGK 79

Query: 376 GFEAAGVTGP-GGEPVKGS 429
           G EA  V+G   G+ +KGS
Sbjct: 80  GREAYAVSGEVEGQGLKGS 98


>Z81494-2|CAB61008.1|  227|Caenorhabditis elegans Hypothetical
           protein F02E9.2a protein.
          Length = 227

 Score = 35.5 bits (78), Expect = 0.047
 Identities = 27/79 (34%), Positives = 40/79 (50%), Gaps = 3/79 (3%)
 Frame = +1

Query: 202 GHCEMVQRQEWIWFHQQDDTKEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVV--AGEK 375
           G C+     +   F   D T ED+FVHQ+    N   +  RS+ +GE V + +   +  K
Sbjct: 55  GSCKWFNVSKGYGFVIDDITGEDLFVHQS----NLNMQGFRSLDEGERVSYYIQERSNGK 110

Query: 376 GFEAAGVTGP-GGEPVKGS 429
           G EA  V+G   G+ +KGS
Sbjct: 111 GREAYAVSGEVEGQGLKGS 129


>U75915-1|AAB49759.1|  227|Caenorhabditis elegans Lin-28 protein.
          Length = 227

 Score = 35.5 bits (78), Expect = 0.047
 Identities = 27/79 (34%), Positives = 40/79 (50%), Gaps = 3/79 (3%)
 Frame = +1

Query: 202 GHCEMVQRQEWIWFHQQDDTKEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVV--AGEK 375
           G C+     +   F   D T ED+FVHQ+    N   +  RS+ +GE V + +   +  K
Sbjct: 55  GSCKWFNVSKGYGFVIDDITGEDLFVHQS----NLNMQGFRSLDEGERVSYYIQERSNGK 110

Query: 376 GFEAAGVTGP-GGEPVKGS 429
           G EA  V+G   G+ +KGS
Sbjct: 111 GREAYAVSGEVEGQGLKGS 129


>U75912-1|AAC47476.1|  227|Caenorhabditis elegans LIN-28 protein.
          Length = 227

 Score = 35.5 bits (78), Expect = 0.047
 Identities = 27/79 (34%), Positives = 40/79 (50%), Gaps = 3/79 (3%)
 Frame = +1

Query: 202 GHCEMVQRQEWIWFHQQDDTKEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVV--AGEK 375
           G C+     +   F   D T ED+FVHQ+    N   +  RS+ +GE V + +   +  K
Sbjct: 55  GSCKWFNVSKGYGFVIDDITGEDLFVHQS----NLNMQGFRSLDEGERVSYYIQERSNGK 110

Query: 376 GFEAAGVTGP-GGEPVKGS 429
           G EA  V+G   G+ +KGS
Sbjct: 111 GREAYAVSGEVEGQGLKGS 129


>Z82278-10|CAC15860.2|  390|Caenorhabditis elegans Hypothetical
           protein Y116F11B.2 protein.
          Length = 390

 Score = 28.3 bits (60), Expect = 7.1
 Identities = 12/28 (42%), Positives = 15/28 (53%)
 Frame = -2

Query: 304 CYGRWQSDAQTHLPWCHPVDETISTLDV 221
           C+G    DA     WC PVDE   T+D+
Sbjct: 79  CFGEGNPDADN---WCVPVDEVPVTIDI 103


>AL132943-14|CAC14395.2|  390|Caenorhabditis elegans Hypothetical
           protein Y116F11B.2 protein.
          Length = 390

 Score = 28.3 bits (60), Expect = 7.1
 Identities = 12/28 (42%), Positives = 15/28 (53%)
 Frame = -2

Query: 304 CYGRWQSDAQTHLPWCHPVDETISTLDV 221
           C+G    DA     WC PVDE   T+D+
Sbjct: 79  CFGEGNPDADN---WCVPVDEVPVTIDI 103


>U88166-3|AAO44910.1|  160|Caenorhabditis elegans Collagen protein
           53 protein.
          Length = 160

 Score = 27.9 bits (59), Expect = 9.3
 Identities = 17/39 (43%), Positives = 21/39 (53%), Gaps = 1/39 (2%)
 Frame = +1

Query: 367 GEKGFEAAGVTGPGGEPVK-GSPYAADKRRGYHRQYFPR 480
           G+KGF   GV GP GEP + G  Y +D   G   +  PR
Sbjct: 49  GDKGFP--GVAGPAGEPGEPGHIYVSDGPPGKDGETGPR 85


>U23527-3|AAC46573.3|  596|Caenorhabditis elegans Hypothetical
           protein K09E2.2 protein.
          Length = 596

 Score = 27.9 bits (59), Expect = 9.3
 Identities = 13/41 (31%), Positives = 20/41 (48%)
 Frame = +1

Query: 253 DDTKEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEK 375
           D+   D+FV    + +   RK V   G    +E A+ +GEK
Sbjct: 211 DELVPDIFVENKLVTKKKLRKKVVKKGLTNTIELALKSGEK 251


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 14,453,602
Number of Sequences: 27780
Number of extensions: 241419
Number of successful extensions: 849
Number of sequences better than 10.0: 13
Number of HSP's better than 10.0 without gapping: 743
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 845
length of database: 12,740,198
effective HSP length: 80
effective length of database: 10,517,798
effective search space used: 2040452812
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -