SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30162.Seq
         (465 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z82077-3|CAB63331.1|  122|Caenorhabditis elegans Hypothetical pr...    97   4e-21
Z82077-4|CAB63332.1|   70|Caenorhabditis elegans Hypothetical pr...    64   5e-11

>Z82077-3|CAB63331.1|  122|Caenorhabditis elegans Hypothetical
           protein W09C5.6a protein.
          Length = 122

 Score = 97.5 bits (232), Expect = 4e-21
 Identities = 43/64 (67%), Positives = 54/64 (84%)
 Frame = +2

Query: 62  PKGERKGKSAINEVVTREYTVNLHKRLHGVGFKKRAPRAIKEIRKFAEKQMGTPDIRVDT 241
           PK E+K +S INEVVTREYT+++H R+ G+G KKRAPRAI EI+KFA+ QM T D+RVDT
Sbjct: 3   PKNEKKSRSTINEVVTREYTIHIHARIRGIGSKKRAPRAIDEIKKFAKIQMKTNDVRVDT 62

Query: 242 RLNK 253
           +LNK
Sbjct: 63  KLNK 66



 Score = 64.1 bits (149), Expect = 5e-11
 Identities = 27/59 (45%), Positives = 37/59 (62%)
 Frame = +1

Query: 244 LKQILWSKGVRNVPFXXXXXXXXXXNDDEDSAHKLFTLVTYVPVASIKGLQTENVDASQ 420
           L + +WSKG++NVP+          N+DEDSA KL+TL TYVP  +  GL   NVD+ +
Sbjct: 64  LNKFIWSKGIKNVPYRVRVRLSRRRNEDEDSAQKLYTLCTYVPCTNFHGLTNVNVDSEE 122


>Z82077-4|CAB63332.1|   70|Caenorhabditis elegans Hypothetical
           protein W09C5.6b protein.
          Length = 70

 Score = 64.1 bits (149), Expect = 5e-11
 Identities = 27/59 (45%), Positives = 37/59 (62%)
 Frame = +1

Query: 244 LKQILWSKGVRNVPFXXXXXXXXXXNDDEDSAHKLFTLVTYVPVASIKGLQTENVDASQ 420
           L + +WSKG++NVP+          N+DEDSA KL+TL TYVP  +  GL   NVD+ +
Sbjct: 12  LNKFIWSKGIKNVPYRVRVRLSRRRNEDEDSAQKLYTLCTYVPCTNFHGLTNVNVDSEE 70


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 9,532,925
Number of Sequences: 27780
Number of extensions: 180411
Number of successful extensions: 405
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 391
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 405
length of database: 12,740,198
effective HSP length: 76
effective length of database: 10,628,918
effective search space used: 829055604
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -