SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30161.Seq
         (888 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AL132865-10|CAB60607.2|  279|Caenorhabditis elegans Hypothetical...    90   2e-18
AL132865-9|CAB60608.2|  276|Caenorhabditis elegans Hypothetical ...    90   2e-18
AL132865-18|CAJ76950.1|  282|Caenorhabditis elegans Hypothetical...    85   8e-17
AL132865-11|CAC42380.2|  265|Caenorhabditis elegans Hypothetical...    85   8e-17
U80846-5|AAP82647.1|  825|Caenorhabditis elegans Hypothetical pr...    34   0.12 
U80846-4|AAC70889.1| 1032|Caenorhabditis elegans Hypothetical pr...    34   0.12 
U80846-3|AAC70890.1| 2232|Caenorhabditis elegans Hypothetical pr...    34   0.12 
U50071-6|AAQ91911.1| 1004|Caenorhabditis elegans Uncoordinated p...    32   0.63 
U50071-5|AAA93443.1| 2039|Caenorhabditis elegans Uncoordinated p...    32   0.63 
U50071-4|AAM75382.1| 1841|Caenorhabditis elegans Uncoordinated p...    32   0.63 
U50071-3|AAA93444.1| 1867|Caenorhabditis elegans Uncoordinated p...    32   0.63 
U50071-2|AAA93447.2| 6994|Caenorhabditis elegans Uncoordinated p...    32   0.63 
U39847-3|AAB41826.1| 1815|Caenorhabditis elegans AO49 ankyrin pr...    32   0.63 
U39847-2|AAB41828.1| 1867|Caenorhabditis elegans AO66 ankyrin pr...    32   0.63 
U39847-1|AAB41827.1| 6994|Caenorhabditis elegans AO13 ankyrin pr...    32   0.63 
U21734-1|AAA85854.1| 1786|Caenorhabditis elegans UNC-44 protein.       32   0.63 
Z48582-8|CAB70201.1| 3178|Caenorhabditis elegans Hypothetical pr...    31   1.1  
Z48544-10|CAB70192.1| 3178|Caenorhabditis elegans Hypothetical p...    31   1.1  
U39852-1|AAK39256.2| 2314|Caenorhabditis elegans Hypothetical pr...    31   1.1  
U53341-6|AAC69106.1|  790|Caenorhabditis elegans Hypothetical pr...    30   1.9  
U53341-5|AAL06020.1|  842|Caenorhabditis elegans Hypothetical pr...    30   1.9  
AC006669-1|AAF39909.1| 1203|Caenorhabditis elegans Hypothetical ...    29   4.4  
Z50070-7|CAA90396.1|   87|Caenorhabditis elegans Hypothetical pr...    29   5.9  
AF045640-6|AAU05588.1| 1562|Caenorhabditis elegans Novel channel...    29   5.9  
AF039047-15|AAM15588.1| 1040|Caenorhabditis elegans Human mlk (m...    29   5.9  
AF039047-14|AAM15589.1|  978|Caenorhabditis elegans Human mlk (m...    29   5.9  
AC090999-21|AAK26150.1|  530|Caenorhabditis elegans Hypothetical...    29   5.9  
Z77661-11|CAB01190.2| 1099|Caenorhabditis elegans Hypothetical p...    28   7.8  
U38377-3|AAA79748.1|  652|Caenorhabditis elegans Cohesin family ...    28   7.8  
U23147-1|AAC46692.2|  674|Caenorhabditis elegans Hypothetical pr...    28   7.8  
U21310-3|AAA62522.2| 1288|Caenorhabditis elegans Hypothetical pr...    28   7.8  
AF067617-5|AAC17559.1| 2957|Caenorhabditis elegans Temporarily a...    28   7.8  

>AL132865-10|CAB60607.2|  279|Caenorhabditis elegans Hypothetical
           protein Y62E10A.13b protein.
          Length = 279

 Score = 89.8 bits (213), Expect = 2e-18
 Identities = 42/82 (51%), Positives = 56/82 (68%)
 Frame = +1

Query: 259 LFRTADCVCFDVDSTVIQDEGIDELAKFCGKGDEVKRLTAEAMGGNMTFQEALKKRLDII 438
           ++R AD VCFDVDSTV QDEGIDELA + G G+ V  +T  AM GN  F++AL  RL ++
Sbjct: 52  VWRKADAVCFDVDSTVCQDEGIDELAAYLGVGEAVANVTRTAMNGNARFRDALAARLQVM 111

Query: 439 RPNVGQIREFIEKFPVRLTPGI 504
           +PN  Q+ +F+     +LT GI
Sbjct: 112 KPNHEQLEQFVNISKPKLTVGI 133



 Score = 76.2 bits (179), Expect = 3e-14
 Identities = 47/98 (47%), Positives = 58/98 (59%), Gaps = 4/98 (4%)
 Frame = +3

Query: 510 LVKELHERGVIVYLVSGGFRSLIEPVAERLNIPTINIFANRLKFYFNGEYAGFDENEPTS 689
           LV  LH RG  VYLVSGGFR LI PVAE L I    I+AN + F   G+Y GFD +E TS
Sbjct: 136 LVSRLHARGTHVYLVSGGFRRLILPVAELLGIEKSRIYANEILFDKFGKYHGFDTSELTS 195

Query: 690 RSG----GXXLVVRRLXELHGYQRLVIVRGPGLPMPEA 791
            SG    G   V+  L +++ Y+ +V+V G G    EA
Sbjct: 196 DSGSKETGKPAVIALLKKMYNYKTVVMV-GDGATDVEA 232


>AL132865-9|CAB60608.2|  276|Caenorhabditis elegans Hypothetical
           protein Y62E10A.13a protein.
          Length = 276

 Score = 89.8 bits (213), Expect = 2e-18
 Identities = 42/82 (51%), Positives = 56/82 (68%)
 Frame = +1

Query: 259 LFRTADCVCFDVDSTVIQDEGIDELAKFCGKGDEVKRLTAEAMGGNMTFQEALKKRLDII 438
           ++R AD VCFDVDSTV QDEGIDELA + G G+ V  +T  AM GN  F++AL  RL ++
Sbjct: 49  VWRKADAVCFDVDSTVCQDEGIDELAAYLGVGEAVANVTRTAMNGNARFRDALAARLQVM 108

Query: 439 RPNVGQIREFIEKFPVRLTPGI 504
           +PN  Q+ +F+     +LT GI
Sbjct: 109 KPNHEQLEQFVNISKPKLTVGI 130



 Score = 76.2 bits (179), Expect = 3e-14
 Identities = 47/98 (47%), Positives = 58/98 (59%), Gaps = 4/98 (4%)
 Frame = +3

Query: 510 LVKELHERGVIVYLVSGGFRSLIEPVAERLNIPTINIFANRLKFYFNGEYAGFDENEPTS 689
           LV  LH RG  VYLVSGGFR LI PVAE L I    I+AN + F   G+Y GFD +E TS
Sbjct: 133 LVSRLHARGTHVYLVSGGFRRLILPVAELLGIEKSRIYANEILFDKFGKYHGFDTSELTS 192

Query: 690 RSG----GXXLVVRRLXELHGYQRLVIVRGPGLPMPEA 791
            SG    G   V+  L +++ Y+ +V+V G G    EA
Sbjct: 193 DSGSKETGKPAVIALLKKMYNYKTVVMV-GDGATDVEA 229


>AL132865-18|CAJ76950.1|  282|Caenorhabditis elegans Hypothetical
           protein Y62E10A.13d protein.
          Length = 282

 Score = 84.6 bits (200), Expect = 8e-17
 Identities = 42/84 (50%), Positives = 56/84 (66%), Gaps = 2/84 (2%)
 Frame = +1

Query: 259 LFRTADCVCFDVDSTVIQDEGIDELAKFCGKGDEVKRLTAEAMGGNMTF--QEALKKRLD 432
           ++R AD VCFDVDSTV QDEGIDELA + G G+ V  +T  AM GN  F  ++AL  RL 
Sbjct: 53  VWRKADAVCFDVDSTVCQDEGIDELAAYLGVGEAVANVTRTAMNGNARFRYRDALAARLQ 112

Query: 433 IIRPNVGQIREFIEKFPVRLTPGI 504
           +++PN  Q+ +F+     +LT GI
Sbjct: 113 VMKPNHEQLEQFVNISKPKLTVGI 136



 Score = 76.2 bits (179), Expect = 3e-14
 Identities = 47/98 (47%), Positives = 58/98 (59%), Gaps = 4/98 (4%)
 Frame = +3

Query: 510 LVKELHERGVIVYLVSGGFRSLIEPVAERLNIPTINIFANRLKFYFNGEYAGFDENEPTS 689
           LV  LH RG  VYLVSGGFR LI PVAE L I    I+AN + F   G+Y GFD +E TS
Sbjct: 139 LVSRLHARGTHVYLVSGGFRRLILPVAELLGIEKSRIYANEILFDKFGKYHGFDTSELTS 198

Query: 690 RSG----GXXLVVRRLXELHGYQRLVIVRGPGLPMPEA 791
            SG    G   V+  L +++ Y+ +V+V G G    EA
Sbjct: 199 DSGSKETGKPAVIALLKKMYNYKTVVMV-GDGATDVEA 235


>AL132865-11|CAC42380.2|  265|Caenorhabditis elegans Hypothetical
           protein Y62E10A.13c protein.
          Length = 265

 Score = 84.6 bits (200), Expect = 8e-17
 Identities = 42/84 (50%), Positives = 56/84 (66%), Gaps = 2/84 (2%)
 Frame = +1

Query: 259 LFRTADCVCFDVDSTVIQDEGIDELAKFCGKGDEVKRLTAEAMGGNMTF--QEALKKRLD 432
           ++R AD VCFDVDSTV QDEGIDELA + G G+ V  +T  AM GN  F  ++AL  RL 
Sbjct: 36  VWRKADAVCFDVDSTVCQDEGIDELAAYLGVGEAVANVTRTAMNGNARFRYRDALAARLQ 95

Query: 433 IIRPNVGQIREFIEKFPVRLTPGI 504
           +++PN  Q+ +F+     +LT GI
Sbjct: 96  VMKPNHEQLEQFVNISKPKLTVGI 119



 Score = 76.2 bits (179), Expect = 3e-14
 Identities = 47/98 (47%), Positives = 58/98 (59%), Gaps = 4/98 (4%)
 Frame = +3

Query: 510 LVKELHERGVIVYLVSGGFRSLIEPVAERLNIPTINIFANRLKFYFNGEYAGFDENEPTS 689
           LV  LH RG  VYLVSGGFR LI PVAE L I    I+AN + F   G+Y GFD +E TS
Sbjct: 122 LVSRLHARGTHVYLVSGGFRRLILPVAELLGIEKSRIYANEILFDKFGKYHGFDTSELTS 181

Query: 690 RSG----GXXLVVRRLXELHGYQRLVIVRGPGLPMPEA 791
            SG    G   V+  L +++ Y+ +V+V G G    EA
Sbjct: 182 DSGSKETGKPAVIALLKKMYNYKTVVMV-GDGATDVEA 218


>U80846-5|AAP82647.1|  825|Caenorhabditis elegans Hypothetical
           protein K06A9.1c protein.
          Length = 825

 Score = 34.3 bits (75), Expect = 0.12
 Identities = 20/80 (25%), Positives = 36/80 (45%)
 Frame = -2

Query: 395 LPPIASAVSLLTSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR*STP 216
           L P  S +S LTS P P +  SS   S+  T      Q+ S++ +++  +  ++    T 
Sbjct: 482 LSPSTSGMSTLTSEPSPSSTQSSGAQSTLTTPSPNPSQSTSSLESSTSGATTSSGSAGTT 541

Query: 215 VRASSTSRTAGCFSNCKEPS 156
           + + S S + G       P+
Sbjct: 542 MTSPSQSSSVGSSQGSTSPA 561



 Score = 29.9 bits (64), Expect = 2.5
 Identities = 23/78 (29%), Positives = 36/78 (46%)
 Frame = -2

Query: 389 PIASAVSLLTSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR*STPVR 210
           P  S+ S +T    P+   +SS   S  +  S + +  S     SG S+G  S  S+P  
Sbjct: 424 PTGSSQSTIT----PEGSTASSPTGSTGSTFSVATEVTSQSTVPSGSSLGTQSTNSSPSP 479

Query: 209 ASSTSRTAGCFSNCKEPS 156
           +S +  T+G  +   EPS
Sbjct: 480 SSLSPSTSGMSTLTSEPS 497


>U80846-4|AAC70889.1| 1032|Caenorhabditis elegans Hypothetical
           protein K06A9.1a protein.
          Length = 1032

 Score = 34.3 bits (75), Expect = 0.12
 Identities = 20/80 (25%), Positives = 36/80 (45%)
 Frame = -2

Query: 395 LPPIASAVSLLTSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR*STP 216
           L P  S +S LTS P P +  SS   S+  T      Q+ S++ +++  +  ++    T 
Sbjct: 689 LSPSTSGMSTLTSEPSPSSTQSSGAQSTLTTPSPNPSQSTSSLESSTSGATTSSGSAGTT 748

Query: 215 VRASSTSRTAGCFSNCKEPS 156
           + + S S + G       P+
Sbjct: 749 MTSPSQSSSVGSSQGSTSPA 768



 Score = 29.9 bits (64), Expect = 2.5
 Identities = 23/78 (29%), Positives = 36/78 (46%)
 Frame = -2

Query: 389 PIASAVSLLTSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR*STPVR 210
           P  S+ S +T    P+   +SS   S  +  S + +  S     SG S+G  S  S+P  
Sbjct: 631 PTGSSQSTIT----PEGSTASSPTGSTGSTFSVATEVTSQSTVPSGSSLGTQSTNSSPSP 686

Query: 209 ASSTSRTAGCFSNCKEPS 156
           +S +  T+G  +   EPS
Sbjct: 687 SSLSPSTSGMSTLTSEPS 704


>U80846-3|AAC70890.1| 2232|Caenorhabditis elegans Hypothetical
           protein K06A9.1b protein.
          Length = 2232

 Score = 34.3 bits (75), Expect = 0.12
 Identities = 20/80 (25%), Positives = 36/80 (45%)
 Frame = -2

Query: 395 LPPIASAVSLLTSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR*STP 216
           L P  S +S LTS P P +  SS   S+  T      Q+ S++ +++  +  ++    T 
Sbjct: 689 LSPSTSGMSTLTSEPSPSSTQSSGAQSTLTTPSPNPSQSTSSLESSTSGATTSSGSAGTT 748

Query: 215 VRASSTSRTAGCFSNCKEPS 156
           + + S S + G       P+
Sbjct: 749 MTSPSQSSSVGSSQGSTSPA 768



 Score = 33.5 bits (73), Expect = 0.21
 Identities = 24/66 (36%), Positives = 37/66 (56%)
 Frame = -2

Query: 380  SAVSLLTSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR*STPVRASS 201
            S V+  T+SP     ASS+ PSS  T+ STS  T  + ++ S  +  A+S+  + V   S
Sbjct: 1500 STVASSTASP----AASSTAPSSTGTMSSTSSGTVGSTISESSTTASASSQTGSTVTMGS 1555

Query: 200  TSRTAG 183
            +S T+G
Sbjct: 1556 SS-TSG 1560



 Score = 33.1 bits (72), Expect = 0.27
 Identities = 24/76 (31%), Positives = 37/76 (48%)
 Frame = -2

Query: 383  ASAVSLLTSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR*STPVRAS 204
            +SA S + SS      ASS+ PSS  T+ STS  T  + ++ S  +   TS   + V   
Sbjct: 1745 SSAGSTVVSST-ASPAASSTAPSSTGTMSSTSSGTVGSTMSQSSTAASTTSHTGSTVTLG 1803

Query: 203  STSRTAGCFSNCKEPS 156
            S+S ++   S  +  S
Sbjct: 1804 SSSTSSNQMSTSQGSS 1819



 Score = 30.7 bits (66), Expect = 1.5
 Identities = 20/66 (30%), Positives = 37/66 (56%)
 Frame = -2

Query: 380  SAVSLLTSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR*STPVRASS 201
            S+V    +S     +++S++PSS  T+ STS  T  + ++ S  +  A+S+  + V   S
Sbjct: 1818 SSVGSTVASSTAGLVSTSTVPSSTGTMGSTSSGTVGSTISESSTTASASSQTGSTVTMGS 1877

Query: 200  TSRTAG 183
            +S T+G
Sbjct: 1878 SS-TSG 1882



 Score = 30.7 bits (66), Expect = 1.5
 Identities = 16/50 (32%), Positives = 29/50 (58%)
 Frame = -2

Query: 338  LASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR*STPVRASSTSRT 189
            +++S++PSS  T+ STS  T  + ++ S  +   +S+  + V   STS T
Sbjct: 1915 VSTSTVPSSTGTMGSTSSGTVGSTISESSTAASTSSQTGSTVTIGSTSGT 1964



 Score = 29.9 bits (64), Expect = 2.5
 Identities = 23/78 (29%), Positives = 36/78 (46%)
 Frame = -2

Query: 389 PIASAVSLLTSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR*STPVR 210
           P  S+ S +T    P+   +SS   S  +  S + +  S     SG S+G  S  S+P  
Sbjct: 631 PTGSSQSTIT----PEGSTASSPTGSTGSTFSVATEVTSQSTVPSGSSLGTQSTNSSPSP 686

Query: 209 ASSTSRTAGCFSNCKEPS 156
           +S +  T+G  +   EPS
Sbjct: 687 SSLSPSTSGMSTLTSEPS 704



 Score = 29.9 bits (64), Expect = 2.5
 Identities = 17/52 (32%), Positives = 32/52 (61%)
 Frame = -2

Query: 338  LASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR*STPVRASSTSRTAG 183
            +++S++PSS  T+ STS  T  + ++ S  +  A+S+  + V   S+S T+G
Sbjct: 1593 VSTSTVPSSTGTMGSTSSGTVGSTISESSTTASASSQTGSTVTMGSSS-TSG 1643



 Score = 29.9 bits (64), Expect = 2.5
 Identities = 17/52 (32%), Positives = 32/52 (61%)
 Frame = -2

Query: 338  LASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR*STPVRASSTSRTAG 183
            +++S++PSS  T+ STS  T  + ++ S  +  A+S+  + V   S+S T+G
Sbjct: 1676 VSTSTVPSSTGTMGSTSSGTVGSTISESSTAASASSQTGSTVTMGSSS-TSG 1726


>U50071-6|AAQ91911.1| 1004|Caenorhabditis elegans Uncoordinated
           protein 44, isoform g protein.
          Length = 1004

 Score = 31.9 bits (69), Expect = 0.63
 Identities = 12/34 (35%), Positives = 20/34 (58%)
 Frame = -1

Query: 840 NQGXPPKPMKPSAGGXKPRASVAPVPGRSPGAGT 739
           N+G PP+P +      + +A  AP PGR+ G+ +
Sbjct: 3   NEGDPPQPQQQQPESQEVQAPAAPEPGRAEGSAS 36


>U50071-5|AAA93443.1| 2039|Caenorhabditis elegans Uncoordinated
           protein 44, isoform a protein.
          Length = 2039

 Score = 31.9 bits (69), Expect = 0.63
 Identities = 12/34 (35%), Positives = 20/34 (58%)
 Frame = -1

Query: 840 NQGXPPKPMKPSAGGXKPRASVAPVPGRSPGAGT 739
           N+G PP+P +      + +A  AP PGR+ G+ +
Sbjct: 3   NEGDPPQPQQQQPESQEVQAPAAPEPGRAEGSAS 36


>U50071-4|AAM75382.1| 1841|Caenorhabditis elegans Uncoordinated
           protein 44, isoform e protein.
          Length = 1841

 Score = 31.9 bits (69), Expect = 0.63
 Identities = 12/34 (35%), Positives = 20/34 (58%)
 Frame = -1

Query: 840 NQGXPPKPMKPSAGGXKPRASVAPVPGRSPGAGT 739
           N+G PP+P +      + +A  AP PGR+ G+ +
Sbjct: 3   NEGDPPQPQQQQPESQEVQAPAAPEPGRAEGSAS 36


>U50071-3|AAA93444.1| 1867|Caenorhabditis elegans Uncoordinated
           protein 44, isoform c protein.
          Length = 1867

 Score = 31.9 bits (69), Expect = 0.63
 Identities = 12/34 (35%), Positives = 20/34 (58%)
 Frame = -1

Query: 840 NQGXPPKPMKPSAGGXKPRASVAPVPGRSPGAGT 739
           N+G PP+P +      + +A  AP PGR+ G+ +
Sbjct: 3   NEGDPPQPQQQQPESQEVQAPAAPEPGRAEGSAS 36


>U50071-2|AAA93447.2| 6994|Caenorhabditis elegans Uncoordinated
           protein 44, isoform f protein.
          Length = 6994

 Score = 31.9 bits (69), Expect = 0.63
 Identities = 12/34 (35%), Positives = 20/34 (58%)
 Frame = -1

Query: 840 NQGXPPKPMKPSAGGXKPRASVAPVPGRSPGAGT 739
           N+G PP+P +      + +A  AP PGR+ G+ +
Sbjct: 3   NEGDPPQPQQQQPESQEVQAPAAPEPGRAEGSAS 36


>U39847-3|AAB41826.1| 1815|Caenorhabditis elegans AO49 ankyrin
           protein.
          Length = 1815

 Score = 31.9 bits (69), Expect = 0.63
 Identities = 12/34 (35%), Positives = 20/34 (58%)
 Frame = -1

Query: 840 NQGXPPKPMKPSAGGXKPRASVAPVPGRSPGAGT 739
           N+G PP+P +      + +A  AP PGR+ G+ +
Sbjct: 3   NEGDPPQPQQQQPESQEVQAPAAPEPGRAEGSAS 36


>U39847-2|AAB41828.1| 1867|Caenorhabditis elegans AO66 ankyrin
           protein.
          Length = 1867

 Score = 31.9 bits (69), Expect = 0.63
 Identities = 12/34 (35%), Positives = 20/34 (58%)
 Frame = -1

Query: 840 NQGXPPKPMKPSAGGXKPRASVAPVPGRSPGAGT 739
           N+G PP+P +      + +A  AP PGR+ G+ +
Sbjct: 3   NEGDPPQPQQQQPESQEVQAPAAPEPGRAEGSAS 36


>U39847-1|AAB41827.1| 6994|Caenorhabditis elegans AO13 ankyrin
           protein.
          Length = 6994

 Score = 31.9 bits (69), Expect = 0.63
 Identities = 12/34 (35%), Positives = 20/34 (58%)
 Frame = -1

Query: 840 NQGXPPKPMKPSAGGXKPRASVAPVPGRSPGAGT 739
           N+G PP+P +      + +A  AP PGR+ G+ +
Sbjct: 3   NEGDPPQPQQQQPESQEVQAPAAPEPGRAEGSAS 36


>U21734-1|AAA85854.1| 1786|Caenorhabditis elegans UNC-44 protein.
          Length = 1786

 Score = 31.9 bits (69), Expect = 0.63
 Identities = 12/34 (35%), Positives = 20/34 (58%)
 Frame = -1

Query: 840 NQGXPPKPMKPSAGGXKPRASVAPVPGRSPGAGT 739
           N+G PP+P +      + +A  AP PGR+ G+ +
Sbjct: 3   NEGDPPQPQQQQPESQEVQAPAAPEPGRAEGSAS 36


>Z48582-8|CAB70201.1| 3178|Caenorhabditis elegans Hypothetical
           protein ZK945.9 protein.
          Length = 3178

 Score = 31.1 bits (67), Expect = 1.1
 Identities = 17/56 (30%), Positives = 32/56 (57%)
 Frame = -2

Query: 362 TSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR*STPVRASSTS 195
           ++SP      S++ PS+  T  S+S  T S+  ++S  S  ++++ ST  + SST+
Sbjct: 482 STSPSSTVTTSTTAPSTSTTGPSSSSSTPSSTASSSVSSTASSTQSSTSTQQSSTT 537



 Score = 29.9 bits (64), Expect = 2.5
 Identities = 20/64 (31%), Positives = 33/64 (51%)
 Frame = -2

Query: 380 SAVSLLTSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR*STPVRASS 201
           + V   TS+       S+S PS+  T+ESTS  T ++  + S  S   T + S+ + +S 
Sbjct: 294 TTVPTSTSTVTTAMSTSTSTPSTSTTIESTS-TTFTSTASTSTSSTSTTQQSSSTITSSP 352

Query: 200 TSRT 189
           +S T
Sbjct: 353 SSTT 356



 Score = 29.5 bits (63), Expect = 3.4
 Identities = 26/102 (25%), Positives = 48/102 (47%), Gaps = 1/102 (0%)
 Frame = -2

Query: 500 PGVSLTGNFSMNSLI*PTLGLMMSSLFFKASWNVILPPIASAVSLLTSSPFPQNLASSSM 321
           P  +LT + +  S   P+   + +S     S + +   + S+ S  T+   P +  S+S 
Sbjct: 428 PTTTLTTSTASTSTTEPSTSTVTTS----PSTSPVTSTVTSSSSSSTTVTTPTSTESTST 483

Query: 320 -PSSCMTVESTSKQTQSAVLNNSGQSVGATSR*STPVRASST 198
            PSS +T  +T+  T +   ++S  +  +T+  S    ASST
Sbjct: 484 SPSSTVTTSTTAPSTSTTGPSSSSSTPSSTASSSVSSTASST 525


>Z48544-10|CAB70192.1| 3178|Caenorhabditis elegans Hypothetical
           protein ZK945.9 protein.
          Length = 3178

 Score = 31.1 bits (67), Expect = 1.1
 Identities = 17/56 (30%), Positives = 32/56 (57%)
 Frame = -2

Query: 362 TSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR*STPVRASSTS 195
           ++SP      S++ PS+  T  S+S  T S+  ++S  S  ++++ ST  + SST+
Sbjct: 482 STSPSSTVTTSTTAPSTSTTGPSSSSSTPSSTASSSVSSTASSTQSSTSTQQSSTT 537



 Score = 29.9 bits (64), Expect = 2.5
 Identities = 20/64 (31%), Positives = 33/64 (51%)
 Frame = -2

Query: 380 SAVSLLTSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR*STPVRASS 201
           + V   TS+       S+S PS+  T+ESTS  T ++  + S  S   T + S+ + +S 
Sbjct: 294 TTVPTSTSTVTTAMSTSTSTPSTSTTIESTS-TTFTSTASTSTSSTSTTQQSSSTITSSP 352

Query: 200 TSRT 189
           +S T
Sbjct: 353 SSTT 356



 Score = 29.5 bits (63), Expect = 3.4
 Identities = 26/102 (25%), Positives = 48/102 (47%), Gaps = 1/102 (0%)
 Frame = -2

Query: 500 PGVSLTGNFSMNSLI*PTLGLMMSSLFFKASWNVILPPIASAVSLLTSSPFPQNLASSSM 321
           P  +LT + +  S   P+   + +S     S + +   + S+ S  T+   P +  S+S 
Sbjct: 428 PTTTLTTSTASTSTTEPSTSTVTTS----PSTSPVTSTVTSSSSSSTTVTTPTSTESTST 483

Query: 320 -PSSCMTVESTSKQTQSAVLNNSGQSVGATSR*STPVRASST 198
            PSS +T  +T+  T +   ++S  +  +T+  S    ASST
Sbjct: 484 SPSSTVTTSTTAPSTSTTGPSSSSSTPSSTASSSVSSTASST 525


>U39852-1|AAK39256.2| 2314|Caenorhabditis elegans Hypothetical protein
            K10C2.1 protein.
          Length = 2314

 Score = 31.1 bits (67), Expect = 1.1
 Identities = 18/72 (25%), Positives = 34/72 (47%)
 Frame = -2

Query: 389  PIASAVSLLTSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR*STPVR 210
            P + AVS  T++P P N +  ++P   +     +    + V  +S  + GA S  +T   
Sbjct: 2228 PTSGAVSSTTNTPSPTNQSPVTLPPPSVATAGPTGPILTVVPVSSAPTSGAVSSTATAAP 2287

Query: 209  ASSTSRTAGCFS 174
              +T++T+   S
Sbjct: 2288 VITTTKTSSVLS 2299


>U53341-6|AAC69106.1|  790|Caenorhabditis elegans Hypothetical
           protein F49E10.2a protein.
          Length = 790

 Score = 30.3 bits (65), Expect = 1.9
 Identities = 20/71 (28%), Positives = 31/71 (43%), Gaps = 1/71 (1%)
 Frame = -2

Query: 395 LPPIASAVSLLTSSPFPQNLASSSMPSSCMTVESTS-KQTQSAVLNNSGQSVGATSR*ST 219
           +PP  S  S  T  P       S+ P+S  T  +T+ K T S   + S  +   TS  +T
Sbjct: 583 VPPTTSTSSTTTQKPSTTTTVPSTTPTSTTTTTTTTPKPTTSTSTSTSTTTTTTTSTTAT 642

Query: 218 PVRASSTSRTA 186
                +T+ T+
Sbjct: 643 TTPQPTTTTTS 653


>U53341-5|AAL06020.1|  842|Caenorhabditis elegans Hypothetical
           protein F49E10.2b protein.
          Length = 842

 Score = 30.3 bits (65), Expect = 1.9
 Identities = 20/71 (28%), Positives = 31/71 (43%), Gaps = 1/71 (1%)
 Frame = -2

Query: 395 LPPIASAVSLLTSSPFPQNLASSSMPSSCMTVESTS-KQTQSAVLNNSGQSVGATSR*ST 219
           +PP  S  S  T  P       S+ P+S  T  +T+ K T S   + S  +   TS  +T
Sbjct: 583 VPPTTSTSSTTTQKPSTTTTVPSTTPTSTTTTTTTTPKPTTSTSTSTSTTTTTTTSTTAT 642

Query: 218 PVRASSTSRTA 186
                +T+ T+
Sbjct: 643 TTPQPTTTTTS 653


>AC006669-1|AAF39909.1| 1203|Caenorhabditis elegans Hypothetical
           protein H43E16.1 protein.
          Length = 1203

 Score = 29.1 bits (62), Expect = 4.4
 Identities = 24/77 (31%), Positives = 34/77 (44%)
 Frame = -2

Query: 386 IASAVSLLTSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR*STPVRA 207
           +AS+    TSS    ++ASSS PS   TV + S  T +     S  + G T    +   +
Sbjct: 489 VASSTIAPTSSQESSSIASSSAPSQSTTVITVS-TTATVSSGQSTSTFGTTIGQGSSFGS 547

Query: 206 SSTSRTAGCFSNCKEPS 156
           S+   T G  S    PS
Sbjct: 548 STIQTTQGTSSFAPIPS 564


>Z50070-7|CAA90396.1|   87|Caenorhabditis elegans Hypothetical
           protein F43G6.7 protein.
          Length = 87

 Score = 28.7 bits (61), Expect = 5.9
 Identities = 15/45 (33%), Positives = 18/45 (40%)
 Frame = +2

Query: 743 PAPGDRPGTGATDARGLXPPADXXXXXXXXPWFXDEXKERXPALV 877
           PAPGD+P  G  D   L PP          P    +  E+ P  V
Sbjct: 25  PAPGDQPVQGPADPAMLPPPHQQPGQAPDPPAAAQDELEQEPEAV 69


>AF045640-6|AAU05588.1| 1562|Caenorhabditis elegans Novel channel
            type/putative nematodecalcium channel protein 1, isoform
            a protein.
          Length = 1562

 Score = 28.7 bits (61), Expect = 5.9
 Identities = 12/45 (26%), Positives = 27/45 (60%)
 Frame = -3

Query: 151  CFFSE*RNYYDRIHFNLIY*LRYYLSFVKVTSVIMKDPLCGKYDE 17
            C+++E  NY++    N    + Y+ SF  + + I+++ L GK+++
Sbjct: 1502 CYWNEGMNYWETDCGNFYGAIIYFCSFYLIITYIVRNLLVGKFEK 1546


>AF039047-15|AAM15588.1| 1040|Caenorhabditis elegans Human mlk
           (mixed lineage kinase)homolog protein 1, isoform a
           protein.
          Length = 1040

 Score = 28.7 bits (61), Expect = 5.9
 Identities = 21/66 (31%), Positives = 30/66 (45%)
 Frame = -2

Query: 401 VILPPIASAVSLLTSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR*S 222
           V +PPIA   S    +P P++  S S   +     ST    +  + + S Q     SR S
Sbjct: 10  VNIPPIAKTRSTSHLAPTPEHHRSVSYEDTTTASTSTDSVPEVRIRSESSQ----VSRES 65

Query: 221 TPVRAS 204
            P+RAS
Sbjct: 66  PPIRAS 71


>AF039047-14|AAM15589.1|  978|Caenorhabditis elegans Human mlk
           (mixed lineage kinase)homolog protein 1, isoform b
           protein.
          Length = 978

 Score = 28.7 bits (61), Expect = 5.9
 Identities = 21/66 (31%), Positives = 30/66 (45%)
 Frame = -2

Query: 401 VILPPIASAVSLLTSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR*S 222
           V +PPIA   S    +P P++  S S   +     ST    +  + + S Q     SR S
Sbjct: 10  VNIPPIAKTRSTSHLAPTPEHHRSVSYEDTTTASTSTDSVPEVRIRSESSQ----VSRES 65

Query: 221 TPVRAS 204
            P+RAS
Sbjct: 66  PPIRAS 71


>AC090999-21|AAK26150.1|  530|Caenorhabditis elegans Hypothetical
           protein Y82E9BR.2 protein.
          Length = 530

 Score = 28.7 bits (61), Expect = 5.9
 Identities = 15/27 (55%), Positives = 19/27 (70%), Gaps = 4/27 (14%)
 Frame = -2

Query: 812 SRQQVGLSLG----HR*PRSPDDHQAL 744
           SR +VGL+ G    H+ PR+P DHQAL
Sbjct: 152 SRVKVGLAEGALVLHQAPRAPQDHQAL 178


>Z77661-11|CAB01190.2| 1099|Caenorhabditis elegans Hypothetical
           protein F40G12.3 protein.
          Length = 1099

 Score = 28.3 bits (60), Expect = 7.8
 Identities = 17/55 (30%), Positives = 24/55 (43%)
 Frame = -2

Query: 353 PFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR*STPVRASSTSRT 189
           P   +  + S  ++ +  EST   TQS     S  S G T+   T  R  S S+T
Sbjct: 522 PHRDDSTTDSKTTTSLDYESTPTSTQSTASTKSSTSEGITTSEQTSHRMFSASKT 576


>U38377-3|AAA79748.1|  652|Caenorhabditis elegans Cohesin family
           protein 1 protein.
          Length = 652

 Score = 28.3 bits (60), Expect = 7.8
 Identities = 13/31 (41%), Positives = 18/31 (58%)
 Frame = +1

Query: 355 DEVKRLTAEAMGGNMTFQEALKKRLDIIRPN 447
           D+VK +T E M GNM     +  RLD+  P+
Sbjct: 385 DDVKMITGEEMKGNMADFSDILTRLDLAPPS 415


>U23147-1|AAC46692.2|  674|Caenorhabditis elegans Hypothetical
           protein C18H9.8 protein.
          Length = 674

 Score = 28.3 bits (60), Expect = 7.8
 Identities = 19/55 (34%), Positives = 28/55 (50%), Gaps = 6/55 (10%)
 Frame = -1

Query: 876 TKAGXLSLXSSXNQGXPPKPMKPSAGGXKPRASVA----PVPG--RSPGAGTRAI 730
           +++G + +  S + G PP PM  S  G  PRA  +    P+ G  R P AG R +
Sbjct: 108 SRSGMIPVPPSRS-GGPPAPMPVSRAGGPPRAPTSMGGRPMTGMARPPTAGLRPV 161


>U21310-3|AAA62522.2| 1288|Caenorhabditis elegans Hypothetical protein
            F40H6.5 protein.
          Length = 1288

 Score = 28.3 bits (60), Expect = 7.8
 Identities = 18/52 (34%), Positives = 30/52 (57%), Gaps = 3/52 (5%)
 Frame = -2

Query: 320  PSSCMTVESTSKQTQSAVLNNSGQSVGATSR---*STPVRASSTSRTAGCFS 174
            PS+ +   STS+ T SA L ++ +++ +TS+    ST  R +S   T+G  S
Sbjct: 913  PSTPLETASTSQSTPSATLTSTTENIPSTSKIPETSTTQRPTSPILTSGATS 964


>AF067617-5|AAC17559.1| 2957|Caenorhabditis elegans Temporarily
            assigned gene nameprotein 192 protein.
          Length = 2957

 Score = 28.3 bits (60), Expect = 7.8
 Identities = 18/52 (34%), Positives = 28/52 (53%), Gaps = 2/52 (3%)
 Frame = -2

Query: 392  PPIASAVSLLTSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLN--NSGQSV 243
            P  +   S  TS+P    +AS+  PS+  +V STS Q  +A  +  NSG+ +
Sbjct: 2859 PTTSKQASASTSTPSTSAVASAQTPST--SVPSTSSQAAAAAASSANSGEDI 2908


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 18,753,024
Number of Sequences: 27780
Number of extensions: 385506
Number of successful extensions: 1476
Number of sequences better than 10.0: 32
Number of HSP's better than 10.0 without gapping: 1288
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1474
length of database: 12,740,198
effective HSP length: 81
effective length of database: 10,490,018
effective search space used: 2244863852
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -