SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30160.Seq
         (904 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF040660-8|AAN65288.1|  594|Caenorhabditis elegans Hypothetical ...   134   1e-31
AF040660-6|AAN65286.1|  541|Caenorhabditis elegans Hypothetical ...   134   1e-31
AF040660-5|AAC71149.1|  651|Caenorhabditis elegans Hypothetical ...   134   1e-31
Z83122-8|CAF31484.1|  582|Caenorhabditis elegans Hypothetical pr...   125   5e-29
Z83122-7|CAF31483.1|  618|Caenorhabditis elegans Hypothetical pr...   125   5e-29
Z83122-6|CAF31482.1|  587|Caenorhabditis elegans Hypothetical pr...   125   5e-29
Z83122-5|CAB05600.1|  654|Caenorhabditis elegans Hypothetical pr...   125   5e-29
AF040660-7|AAN65287.1|  366|Caenorhabditis elegans Hypothetical ...    62   4e-10
AF125442-11|AAD12791.1|  624|Caenorhabditis elegans Hypothetical...    54   2e-07
Z71178-8|CAA94882.1|  552|Caenorhabditis elegans Hypothetical pr...    30   2.0  
U23168-4|AAU87833.1| 1379|Caenorhabditis elegans Temporarily ass...    29   3.4  
U23168-3|AAU87831.1| 4034|Caenorhabditis elegans Temporarily ass...    29   3.4  
U23168-2|AAC38806.2| 1633|Caenorhabditis elegans Temporarily ass...    29   3.4  
U23168-1|AAU87832.1| 7548|Caenorhabditis elegans Temporarily ass...    29   3.4  

>AF040660-8|AAN65288.1|  594|Caenorhabditis elegans Hypothetical
           protein W05G11.6d protein.
          Length = 594

 Score =  134 bits (323), Expect = 1e-31
 Identities = 68/129 (52%), Positives = 85/129 (65%), Gaps = 6/129 (4%)
 Frame = +3

Query: 249 SEVLEILRQDEQFVRCLHAVG------SGGTPGWPCDPKNTIILHKPAENEIVXXXXXXX 410
           ++VLE L  D  FVRC+H+VG            WPC+P+  +I H+P E EI        
Sbjct: 196 TKVLEALG-DNDFVRCIHSVGLPRPVKQKVINHWPCNPEKVMIAHRPKEREIWSFGSGYG 254

Query: 411 XXXXXXKKCFALRLGSVIARREGWLAEHMLIVGITNPQGKKRYIAAAFPSACGKTNLAMM 590
                 KKCFALR+   I R EGWLAEHMLI+G+TNP+G++++IAAAFPSACGKTNLAM+
Sbjct: 255 GNSILGKKCFALRIACNIGRDEGWLAEHMLIMGVTNPEGEEKFIAAAFPSACGKTNLAML 314

Query: 591 TPNTGPGTK 617
           TP T PG K
Sbjct: 315 TP-TVPGWK 322



 Score = 74.5 bits (175), Expect = 9e-14
 Identities = 31/44 (70%), Positives = 37/44 (84%)
 Frame = +1

Query: 124 GRTMYVIPFSMGPVGSPLSKIGVEITDSPYVVYSMRVMTRIGAK 255
           GR MYV+P+SMGP+G PLSK G+E+TDSPYVV  MR MTR+G K
Sbjct: 154 GRPMYVVPYSMGPIGGPLSKNGIELTDSPYVVLCMRTMTRMGTK 197



 Score = 31.5 bits (68), Expect = 0.85
 Identities = 17/36 (47%), Positives = 21/36 (58%)
 Frame = +2

Query: 605 PGYKVXCVGDDIALMKFRXRTAYFRGHLXRKNGFFG 712
           PG+KV  VGDDIA MKF      +   +  + GFFG
Sbjct: 319 PGWKVRVVGDDIAWMKFGADGRLYA--INPEAGFFG 352


>AF040660-6|AAN65286.1|  541|Caenorhabditis elegans Hypothetical
           protein W05G11.6b protein.
          Length = 541

 Score =  134 bits (323), Expect = 1e-31
 Identities = 68/129 (52%), Positives = 85/129 (65%), Gaps = 6/129 (4%)
 Frame = +3

Query: 249 SEVLEILRQDEQFVRCLHAVG------SGGTPGWPCDPKNTIILHKPAENEIVXXXXXXX 410
           ++VLE L  D  FVRC+H+VG            WPC+P+  +I H+P E EI        
Sbjct: 86  TKVLEALG-DNDFVRCIHSVGLPRPVKQKVINHWPCNPEKVMIAHRPKEREIWSFGSGYG 144

Query: 411 XXXXXXKKCFALRLGSVIARREGWLAEHMLIVGITNPQGKKRYIAAAFPSACGKTNLAMM 590
                 KKCFALR+   I R EGWLAEHMLI+G+TNP+G++++IAAAFPSACGKTNLAM+
Sbjct: 145 GNSILGKKCFALRIACNIGRDEGWLAEHMLIMGVTNPEGEEKFIAAAFPSACGKTNLAML 204

Query: 591 TPNTGPGTK 617
           TP T PG K
Sbjct: 205 TP-TVPGWK 212



 Score = 74.5 bits (175), Expect = 9e-14
 Identities = 31/44 (70%), Positives = 37/44 (84%)
 Frame = +1

Query: 124 GRTMYVIPFSMGPVGSPLSKIGVEITDSPYVVYSMRVMTRIGAK 255
           GR MYV+P+SMGP+G PLSK G+E+TDSPYVV  MR MTR+G K
Sbjct: 44  GRPMYVVPYSMGPIGGPLSKNGIELTDSPYVVLCMRTMTRMGTK 87



 Score = 31.5 bits (68), Expect = 0.85
 Identities = 17/36 (47%), Positives = 21/36 (58%)
 Frame = +2

Query: 605 PGYKVXCVGDDIALMKFRXRTAYFRGHLXRKNGFFG 712
           PG+KV  VGDDIA MKF      +   +  + GFFG
Sbjct: 209 PGWKVRVVGDDIAWMKFGADGRLYA--INPEAGFFG 242


>AF040660-5|AAC71149.1|  651|Caenorhabditis elegans Hypothetical
           protein W05G11.6a protein.
          Length = 651

 Score =  134 bits (323), Expect = 1e-31
 Identities = 68/129 (52%), Positives = 85/129 (65%), Gaps = 6/129 (4%)
 Frame = +3

Query: 249 SEVLEILRQDEQFVRCLHAVG------SGGTPGWPCDPKNTIILHKPAENEIVXXXXXXX 410
           ++VLE L  D  FVRC+H+VG            WPC+P+  +I H+P E EI        
Sbjct: 196 TKVLEALG-DNDFVRCIHSVGLPRPVKQKVINHWPCNPEKVMIAHRPKEREIWSFGSGYG 254

Query: 411 XXXXXXKKCFALRLGSVIARREGWLAEHMLIVGITNPQGKKRYIAAAFPSACGKTNLAMM 590
                 KKCFALR+   I R EGWLAEHMLI+G+TNP+G++++IAAAFPSACGKTNLAM+
Sbjct: 255 GNSILGKKCFALRIACNIGRDEGWLAEHMLIMGVTNPEGEEKFIAAAFPSACGKTNLAML 314

Query: 591 TPNTGPGTK 617
           TP T PG K
Sbjct: 315 TP-TVPGWK 322



 Score = 74.5 bits (175), Expect = 9e-14
 Identities = 31/44 (70%), Positives = 37/44 (84%)
 Frame = +1

Query: 124 GRTMYVIPFSMGPVGSPLSKIGVEITDSPYVVYSMRVMTRIGAK 255
           GR MYV+P+SMGP+G PLSK G+E+TDSPYVV  MR MTR+G K
Sbjct: 154 GRPMYVVPYSMGPIGGPLSKNGIELTDSPYVVLCMRTMTRMGTK 197



 Score = 31.5 bits (68), Expect = 0.85
 Identities = 17/36 (47%), Positives = 21/36 (58%)
 Frame = +2

Query: 605 PGYKVXCVGDDIALMKFRXRTAYFRGHLXRKNGFFG 712
           PG+KV  VGDDIA MKF      +   +  + GFFG
Sbjct: 319 PGWKVRVVGDDIAWMKFGADGRLYA--INPEAGFFG 352


>Z83122-8|CAF31484.1|  582|Caenorhabditis elegans Hypothetical
           protein R11A5.4b protein.
          Length = 582

 Score =  125 bits (301), Expect = 5e-29
 Identities = 61/120 (50%), Positives = 78/120 (65%), Gaps = 6/120 (5%)
 Frame = +3

Query: 276 DEQFVRCLHAVG------SGGTPGWPCDPKNTIILHKPAENEIVXXXXXXXXXXXXXKKC 437
           ++ FVRC+H+VG            WPC+P+  +I H+P E EI              KKC
Sbjct: 217 NQDFVRCIHSVGLPRPVKQRVINHWPCNPERVLIAHRPPEREIWSFGSGYGGNSLLGKKC 276

Query: 438 FALRLGSVIARREGWLAEHMLIVGITNPQGKKRYIAAAFPSACGKTNLAMMTPNTGPGTK 617
           FALR+ S IA+ EGW+AEHMLI+G+T P G++ +IAAAFPSACGKTNLAM+ P T PG K
Sbjct: 277 FALRIASNIAKDEGWMAEHMLIMGVTRPCGREHFIAAAFPSACGKTNLAMLEP-TLPGWK 335



 Score = 74.1 bits (174), Expect = 1e-13
 Identities = 32/41 (78%), Positives = 37/41 (90%)
 Frame = +1

Query: 124 GRTMYVIPFSMGPVGSPLSKIGVEITDSPYVVYSMRVMTRI 246
           GR MYVIPFSMGPVG PLSKIG+++TDS YVV SMR+MTR+
Sbjct: 167 GRIMYVIPFSMGPVGGPLSKIGIQLTDSNYVVLSMRIMTRV 207



 Score = 35.5 bits (78), Expect = 0.052
 Identities = 18/36 (50%), Positives = 22/36 (61%)
 Frame = +2

Query: 605 PGYKVXCVGDDIALMKFRXRTAYFRGHLXRKNGFFG 712
           PG+KV CVGDDIA MKF      +   +  + GFFG
Sbjct: 332 PGWKVRCVGDDIAWMKFGEDGRLYA--INPEAGFFG 365


>Z83122-7|CAF31483.1|  618|Caenorhabditis elegans Hypothetical
           protein R11A5.4d protein.
          Length = 618

 Score =  125 bits (301), Expect = 5e-29
 Identities = 61/120 (50%), Positives = 78/120 (65%), Gaps = 6/120 (5%)
 Frame = +3

Query: 276 DEQFVRCLHAVG------SGGTPGWPCDPKNTIILHKPAENEIVXXXXXXXXXXXXXKKC 437
           ++ FVRC+H+VG            WPC+P+  +I H+P E EI              KKC
Sbjct: 181 NQDFVRCIHSVGLPRPVKQRVINHWPCNPERVLIAHRPPEREIWSFGSGYGGNSLLGKKC 240

Query: 438 FALRLGSVIARREGWLAEHMLIVGITNPQGKKRYIAAAFPSACGKTNLAMMTPNTGPGTK 617
           FALR+ S IA+ EGW+AEHMLI+G+T P G++ +IAAAFPSACGKTNLAM+ P T PG K
Sbjct: 241 FALRIASNIAKDEGWMAEHMLIMGVTRPCGREHFIAAAFPSACGKTNLAMLEP-TLPGWK 299



 Score = 74.1 bits (174), Expect = 1e-13
 Identities = 32/41 (78%), Positives = 37/41 (90%)
 Frame = +1

Query: 124 GRTMYVIPFSMGPVGSPLSKIGVEITDSPYVVYSMRVMTRI 246
           GR MYVIPFSMGPVG PLSKIG+++TDS YVV SMR+MTR+
Sbjct: 131 GRIMYVIPFSMGPVGGPLSKIGIQLTDSNYVVLSMRIMTRV 171



 Score = 35.5 bits (78), Expect = 0.052
 Identities = 18/36 (50%), Positives = 22/36 (61%)
 Frame = +2

Query: 605 PGYKVXCVGDDIALMKFRXRTAYFRGHLXRKNGFFG 712
           PG+KV CVGDDIA MKF      +   +  + GFFG
Sbjct: 296 PGWKVRCVGDDIAWMKFGEDGRLYA--INPEAGFFG 329


>Z83122-6|CAF31482.1|  587|Caenorhabditis elegans Hypothetical
           protein R11A5.4c protein.
          Length = 587

 Score =  125 bits (301), Expect = 5e-29
 Identities = 61/120 (50%), Positives = 78/120 (65%), Gaps = 6/120 (5%)
 Frame = +3

Query: 276 DEQFVRCLHAVG------SGGTPGWPCDPKNTIILHKPAENEIVXXXXXXXXXXXXXKKC 437
           ++ FVRC+H+VG            WPC+P+  +I H+P E EI              KKC
Sbjct: 150 NQDFVRCIHSVGLPRPVKQRVINHWPCNPERVLIAHRPPEREIWSFGSGYGGNSLLGKKC 209

Query: 438 FALRLGSVIARREGWLAEHMLIVGITNPQGKKRYIAAAFPSACGKTNLAMMTPNTGPGTK 617
           FALR+ S IA+ EGW+AEHMLI+G+T P G++ +IAAAFPSACGKTNLAM+ P T PG K
Sbjct: 210 FALRIASNIAKDEGWMAEHMLIMGVTRPCGREHFIAAAFPSACGKTNLAMLEP-TLPGWK 268



 Score = 74.1 bits (174), Expect = 1e-13
 Identities = 32/41 (78%), Positives = 37/41 (90%)
 Frame = +1

Query: 124 GRTMYVIPFSMGPVGSPLSKIGVEITDSPYVVYSMRVMTRI 246
           GR MYVIPFSMGPVG PLSKIG+++TDS YVV SMR+MTR+
Sbjct: 100 GRIMYVIPFSMGPVGGPLSKIGIQLTDSNYVVLSMRIMTRV 140



 Score = 35.5 bits (78), Expect = 0.052
 Identities = 18/36 (50%), Positives = 22/36 (61%)
 Frame = +2

Query: 605 PGYKVXCVGDDIALMKFRXRTAYFRGHLXRKNGFFG 712
           PG+KV CVGDDIA MKF      +   +  + GFFG
Sbjct: 265 PGWKVRCVGDDIAWMKFGEDGRLYA--INPEAGFFG 298


>Z83122-5|CAB05600.1|  654|Caenorhabditis elegans Hypothetical
           protein R11A5.4a protein.
          Length = 654

 Score =  125 bits (301), Expect = 5e-29
 Identities = 61/120 (50%), Positives = 78/120 (65%), Gaps = 6/120 (5%)
 Frame = +3

Query: 276 DEQFVRCLHAVG------SGGTPGWPCDPKNTIILHKPAENEIVXXXXXXXXXXXXXKKC 437
           ++ FVRC+H+VG            WPC+P+  +I H+P E EI              KKC
Sbjct: 217 NQDFVRCIHSVGLPRPVKQRVINHWPCNPERVLIAHRPPEREIWSFGSGYGGNSLLGKKC 276

Query: 438 FALRLGSVIARREGWLAEHMLIVGITNPQGKKRYIAAAFPSACGKTNLAMMTPNTGPGTK 617
           FALR+ S IA+ EGW+AEHMLI+G+T P G++ +IAAAFPSACGKTNLAM+ P T PG K
Sbjct: 277 FALRIASNIAKDEGWMAEHMLIMGVTRPCGREHFIAAAFPSACGKTNLAMLEP-TLPGWK 335



 Score = 74.1 bits (174), Expect = 1e-13
 Identities = 32/41 (78%), Positives = 37/41 (90%)
 Frame = +1

Query: 124 GRTMYVIPFSMGPVGSPLSKIGVEITDSPYVVYSMRVMTRI 246
           GR MYVIPFSMGPVG PLSKIG+++TDS YVV SMR+MTR+
Sbjct: 167 GRIMYVIPFSMGPVGGPLSKIGIQLTDSNYVVLSMRIMTRV 207



 Score = 35.5 bits (78), Expect = 0.052
 Identities = 18/36 (50%), Positives = 22/36 (61%)
 Frame = +2

Query: 605 PGYKVXCVGDDIALMKFRXRTAYFRGHLXRKNGFFG 712
           PG+KV CVGDDIA MKF      +   +  + GFFG
Sbjct: 332 PGWKVRCVGDDIAWMKFGEDGRLYA--INPEAGFFG 365


>AF040660-7|AAN65287.1|  366|Caenorhabditis elegans Hypothetical
           protein W05G11.6c protein.
          Length = 366

 Score = 62.5 bits (145), Expect = 4e-10
 Identities = 27/38 (71%), Positives = 35/38 (92%)
 Frame = +3

Query: 504 VGITNPQGKKRYIAAAFPSACGKTNLAMMTPNTGPGTK 617
           +G+TNP+G++++IAAAFPSACGKTNLAM+TP T PG K
Sbjct: 1   MGVTNPEGEEKFIAAAFPSACGKTNLAMLTP-TVPGWK 37



 Score = 31.5 bits (68), Expect = 0.85
 Identities = 17/36 (47%), Positives = 21/36 (58%)
 Frame = +2

Query: 605 PGYKVXCVGDDIALMKFRXRTAYFRGHLXRKNGFFG 712
           PG+KV  VGDDIA MKF      +   +  + GFFG
Sbjct: 34  PGWKVRVVGDDIAWMKFGADGRLYA--INPEAGFFG 67


>AF125442-11|AAD12791.1|  624|Caenorhabditis elegans Hypothetical
           protein H04M03.1 protein.
          Length = 624

 Score = 53.6 bits (123), Expect = 2e-07
 Identities = 22/41 (53%), Positives = 31/41 (75%)
 Frame = +1

Query: 124 GRTMYVIPFSMGPVGSPLSKIGVEITDSPYVVYSMRVMTRI 246
           GRTMYV+PFSMG +GS  + +GV+ITD P +V ++R   R+
Sbjct: 179 GRTMYVVPFSMGTIGSRRAVVGVQITDDPVLVLNLRTTFRV 219



 Score = 35.5 bits (78), Expect = 0.052
 Identities = 25/99 (25%), Positives = 42/99 (42%), Gaps = 7/99 (7%)
 Frame = +3

Query: 249 SEVLEILRQDEQFVRCLHAVGSGG-------TPGWPCDPKNTIILHKPAENEIVXXXXXX 407
           S + + +     F+RC+H +G          TP     P  + ++ K  + E V      
Sbjct: 221 SNIWDHIAATTNFLRCVHTIGMPRPIIRKIVTPSPVETPVGSFLVLKHDDQE-VWAHGHS 279

Query: 408 XXXXXXXKKCFALRLGSVIARREGWLAEHMLIVGITNPQ 524
                   K F++   S +  ++GWLAE   I+ ITNP+
Sbjct: 280 FGRTPRYGKTFSVHAASWLGAKQGWLAESAAILAITNPK 318


>Z71178-8|CAA94882.1|  552|Caenorhabditis elegans Hypothetical
           protein B0024.10 protein.
          Length = 552

 Score = 30.3 bits (65), Expect = 2.0
 Identities = 17/56 (30%), Positives = 34/56 (60%), Gaps = 1/56 (1%)
 Frame = -2

Query: 315 RSRLREDNERTARLDVEFLELRSNSSHDSHRINHVRR-IRDFYADLRERRSHRTHR 151
           +++L+E+NER   LDV F++L++ ++ +  R+  +R+   D   + RE+R     R
Sbjct: 155 QAKLQEENERKKALDVNFVKLKAENA-ERDRLERLRQEAFDKDKESREKREQEQLR 209


>U23168-4|AAU87833.1| 1379|Caenorhabditis elegans Temporarily
           assigned gene nameprotein 308, isoform d protein.
          Length = 1379

 Score = 29.5 bits (63), Expect = 3.4
 Identities = 14/23 (60%), Positives = 16/23 (69%), Gaps = 3/23 (13%)
 Frame = +2

Query: 464 RSSRRMAGRTYA---YRRHNQPS 523
           RS RR  GRT++   YRRH QPS
Sbjct: 387 RSERRSGGRTHSHEEYRRHQQPS 409


>U23168-3|AAU87831.1| 4034|Caenorhabditis elegans Temporarily
           assigned gene nameprotein 308, isoform b protein.
          Length = 4034

 Score = 29.5 bits (63), Expect = 3.4
 Identities = 14/23 (60%), Positives = 16/23 (69%), Gaps = 3/23 (13%)
 Frame = +2

Query: 464 RSSRRMAGRTYA---YRRHNQPS 523
           RS RR  GRT++   YRRH QPS
Sbjct: 387 RSERRSGGRTHSHEEYRRHQQPS 409


>U23168-2|AAC38806.2| 1633|Caenorhabditis elegans Temporarily
           assigned gene nameprotein 308, isoform a protein.
          Length = 1633

 Score = 29.5 bits (63), Expect = 3.4
 Identities = 14/23 (60%), Positives = 16/23 (69%), Gaps = 3/23 (13%)
 Frame = +2

Query: 464 RSSRRMAGRTYA---YRRHNQPS 523
           RS RR  GRT++   YRRH QPS
Sbjct: 387 RSERRSGGRTHSHEEYRRHQQPS 409


>U23168-1|AAU87832.1| 7548|Caenorhabditis elegans Temporarily
           assigned gene nameprotein 308, isoform c protein.
          Length = 7548

 Score = 29.5 bits (63), Expect = 3.4
 Identities = 14/23 (60%), Positives = 16/23 (69%), Gaps = 3/23 (13%)
 Frame = +2

Query: 464 RSSRRMAGRTYA---YRRHNQPS 523
           RS RR  GRT++   YRRH QPS
Sbjct: 387 RSERRSGGRTHSHEEYRRHQQPS 409


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 19,307,455
Number of Sequences: 27780
Number of extensions: 394309
Number of successful extensions: 1040
Number of sequences better than 10.0: 14
Number of HSP's better than 10.0 without gapping: 945
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1025
length of database: 12,740,198
effective HSP length: 81
effective length of database: 10,490,018
effective search space used: 2297313942
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -