SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30159.Seq
         (712 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z79757-6|CAB02127.1|  350|Caenorhabditis elegans Hypothetical pr...    29   4.3  
AC006675-10|AAK84551.2|  280|Caenorhabditis elegans Serpentine r...    29   4.3  

>Z79757-6|CAB02127.1|  350|Caenorhabditis elegans Hypothetical
           protein F55B12.6 protein.
          Length = 350

 Score = 28.7 bits (61), Expect = 4.3
 Identities = 17/36 (47%), Positives = 20/36 (55%)
 Frame = -3

Query: 428 VALLSIVFSYSYFCFNSILFRLNLLRRPHKYINYVY 321
           V  +S VFS    CFNSIL  L + + P K  NY Y
Sbjct: 11  VQWISFVFS---ICFNSILIFLIITQSPKKMGNYRY 43


>AC006675-10|AAK84551.2|  280|Caenorhabditis elegans Serpentine
           receptor, class bc (class b-like) protein 57 protein.
          Length = 280

 Score = 28.7 bits (61), Expect = 4.3
 Identities = 23/59 (38%), Positives = 33/59 (55%), Gaps = 1/59 (1%)
 Frame = -2

Query: 273 VMIIISKISLQFELLLPSCHRCL-VQYQFVEVINKTLKSDLNTKLELFTMYVFNLFFYL 100
           ++ I  K+SL+ +L L  C     + + FV V+NK L S +   L   TM+V NL FYL
Sbjct: 29  LIFIAKKVSLKPDLKLIYCRFVAEIFFHFVVVLNK-LYSIVG--LVSTTMFVKNLIFYL 84


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 12,645,509
Number of Sequences: 27780
Number of extensions: 225437
Number of successful extensions: 468
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 463
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 468
length of database: 12,740,198
effective HSP length: 79
effective length of database: 10,545,578
effective search space used: 1655655746
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -