SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30158.Seq
         (813 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z78016-2|CAB01443.1|  240|Caenorhabditis elegans Hypothetical pr...    48   6e-06
Z93389-1|CAB07668.1|  346|Caenorhabditis elegans Hypothetical pr...    29   3.0  
U53150-7|ABB51189.1| 1375|Caenorhabditis elegans Twik family of ...    29   3.0  
U53150-6|ABB51187.1| 1544|Caenorhabditis elegans Twik family of ...    29   3.0  
U53150-5|ABB51188.1| 1720|Caenorhabditis elegans Twik family of ...    29   3.0  
U39674-5|AAA80415.2|  229|Caenorhabditis elegans Ubiquitin conju...    29   3.0  

>Z78016-2|CAB01443.1|  240|Caenorhabditis elegans Hypothetical
           protein R186.3 protein.
          Length = 240

 Score = 48.4 bits (110), Expect = 6e-06
 Identities = 28/76 (36%), Positives = 37/76 (48%), Gaps = 2/76 (2%)
 Frame = +3

Query: 282 YSQYXQTFTSMKENIEXXITSNKTLKIVDLPGXERLRNKFFXQHXSSAK--GIVFVIXSI 455
           Y    +T+TSM EN       +K  +I+D PG +RLR K    H  S     IVFV+ S 
Sbjct: 65  YPTTTKTYTSMVENKITLRIKDKEKEIIDYPGNDRLRQKLIENHLHSRSLLRIVFVVDSA 124

Query: 456 NIXEEIXDVAXYLYTI 503
              +   DVA   YT+
Sbjct: 125 AFSKNARDVAELFYTV 140


>Z93389-1|CAB07668.1|  346|Caenorhabditis elegans Hypothetical
           protein T13F3.1 protein.
          Length = 346

 Score = 29.5 bits (63), Expect = 3.0
 Identities = 12/31 (38%), Positives = 17/31 (54%)
 Frame = -1

Query: 117 FCMNLFFNHFRFHCRVLSLHTH*VTKLICTL 25
           FCM +F  HF +    +  HT  + KL+C L
Sbjct: 104 FCMGIFGIHFFYRYLAIYGHTEMIRKLVCIL 134


>U53150-7|ABB51189.1| 1375|Caenorhabditis elegans Twik family of
           potassium channelsprotein 11, isoform c protein.
          Length = 1375

 Score = 29.5 bits (63), Expect = 3.0
 Identities = 21/65 (32%), Positives = 33/65 (50%), Gaps = 3/65 (4%)
 Frame = +1

Query: 64  RKNSTMESEVVKEKIHTEPILNDPRYITLLSLIV-LAVTLIF--WWIFSRRYTLRNSVLL 234
           R NST E +  +E+IH +P +      T+  +I+  AV  +F  W  F+  Y    S+  
Sbjct: 282 RLNSTPEDDEEEEEIHQDPPVLSTLIATVAWIILSAAVFCLFEDWTFFTSFYFCFISLTT 341

Query: 235 MGLSD 249
           +GL D
Sbjct: 342 IGLGD 346


>U53150-6|ABB51187.1| 1544|Caenorhabditis elegans Twik family of
           potassium channelsprotein 11, isoform a protein.
          Length = 1544

 Score = 29.5 bits (63), Expect = 3.0
 Identities = 21/65 (32%), Positives = 33/65 (50%), Gaps = 3/65 (4%)
 Frame = +1

Query: 64  RKNSTMESEVVKEKIHTEPILNDPRYITLLSLIV-LAVTLIF--WWIFSRRYTLRNSVLL 234
           R NST E +  +E+IH +P +      T+  +I+  AV  +F  W  F+  Y    S+  
Sbjct: 282 RLNSTPEDDEEEEEIHQDPPVLSTLIATVAWIILSAAVFCLFEDWTFFTSFYFCFISLTT 341

Query: 235 MGLSD 249
           +GL D
Sbjct: 342 IGLGD 346


>U53150-5|ABB51188.1| 1720|Caenorhabditis elegans Twik family of
           potassium channelsprotein 11, isoform b protein.
          Length = 1720

 Score = 29.5 bits (63), Expect = 3.0
 Identities = 21/65 (32%), Positives = 33/65 (50%), Gaps = 3/65 (4%)
 Frame = +1

Query: 64  RKNSTMESEVVKEKIHTEPILNDPRYITLLSLIV-LAVTLIF--WWIFSRRYTLRNSVLL 234
           R NST E +  +E+IH +P +      T+  +I+  AV  +F  W  F+  Y    S+  
Sbjct: 282 RLNSTPEDDEEEEEIHQDPPVLSTLIATVAWIILSAAVFCLFEDWTFFTSFYFCFISLTT 341

Query: 235 MGLSD 249
           +GL D
Sbjct: 342 IGLGD 346


>U39674-5|AAA80415.2|  229|Caenorhabditis elegans Ubiquitin
           conjugating enzyme protein21 protein.
          Length = 229

 Score = 29.5 bits (63), Expect = 3.0
 Identities = 13/26 (50%), Positives = 17/26 (65%)
 Frame = -2

Query: 545 LXGELCSPE*SDPQDXV*VXXYISDF 468
           L   LCSPE SDPQD V    +I+++
Sbjct: 142 LQAMLCSPEPSDPQDAVVAKQFINNY 167


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 15,377,778
Number of Sequences: 27780
Number of extensions: 275142
Number of successful extensions: 587
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 532
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 586
length of database: 12,740,198
effective HSP length: 80
effective length of database: 10,517,798
effective search space used: 1998381620
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -