SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30155.Seq
         (883 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U12966-4|AAA20616.1|  365|Caenorhabditis elegans Carbonic anhydr...    30   2.5  
AC199172-11|ABO33270.1|  311|Caenorhabditis elegans F-box a prot...    29   5.8  

>U12966-4|AAA20616.1|  365|Caenorhabditis elegans Carbonic anhydrase
           protein 1 protein.
          Length = 365

 Score = 29.9 bits (64), Expect = 2.5
 Identities = 13/30 (43%), Positives = 19/30 (63%), Gaps = 1/30 (3%)
 Frame = +1

Query: 697 ITLINASIILKKEEYEYSTF-PWRLIPFLR 783
           +T+  ASI  K +  + + F PWRL+PF R
Sbjct: 256 LTIATASISYKDQRVQLADFEPWRLLPFTR 285


>AC199172-11|ABO33270.1|  311|Caenorhabditis elegans F-box a protein
           protein 50, isoforma protein.
          Length = 311

 Score = 28.7 bits (61), Expect = 5.8
 Identities = 18/62 (29%), Positives = 27/62 (43%)
 Frame = +1

Query: 616 TFRGNVRGTPICLFF*IHSNMYXAHETITLINASIILKKEEYEYSTFPWRLIPFLRHFXF 795
           T R ++ G  I  FF   S      +    I  +I ++ +    STF W +I FLR    
Sbjct: 203 TIRYSIFGAKIAHFFHFKSFYIYTLDKFKAIQTAIQIRDDLLRRSTFQWCVIRFLRPNAN 262

Query: 796 PV 801
           P+
Sbjct: 263 PI 264


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 19,533,873
Number of Sequences: 27780
Number of extensions: 406014
Number of successful extensions: 911
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 856
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 911
length of database: 12,740,198
effective HSP length: 81
effective length of database: 10,490,018
effective search space used: 2223883816
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -