SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30153.Seq
         (864 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AL132948-30|CAB61063.1|  365|Caenorhabditis elegans Hypothetical...    97   1e-20
AC084159-15|AAK39353.1|  418|Caenorhabditis elegans Hypothetical...    28   7.5  
Z78542-7|CAB01750.1|  300|Caenorhabditis elegans Hypothetical pr...    28   9.9  

>AL132948-30|CAB61063.1|  365|Caenorhabditis elegans Hypothetical
           protein Y39B6A.39 protein.
          Length = 365

 Score = 97.5 bits (232), Expect = 1e-20
 Identities = 46/97 (47%), Positives = 64/97 (65%), Gaps = 3/97 (3%)
 Frame = +2

Query: 233 R*DRQDGPNQNWGNVWPGPKTFHPSSVPLPIRQGYVP--KGQAPPGKKANAELMKIPNFL 406
           R +  D   Q W +VWP  +TF  S VPLP+R G  P  + +AP  K+ N EL+KIPNFL
Sbjct: 94  RSEEMDPEAQKWCDVWPAARTFASSVVPLPVRMGTRPNVEKRAPFKKEGNLELVKIPNFL 153

Query: 407 HLTPPVIKSQCEALKQFCTEW-PNLLNSEESIEKHIP 514
           HLTPP I+  C+A+K+FCT + P LL++  +  +H+P
Sbjct: 154 HLTPPAIQQHCQAIKKFCTPFPPELLSNPSATCQHLP 190



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 29/77 (37%), Positives = 45/77 (58%)
 Frame = +1

Query: 511 PLEIISSDYCHASPSIRNPLARVVILRVQLADLKLDKHATDKFKRLVGDRYDPKTDLVTI 690
           P+ I  S Y H   SIR+  +RVV +++ +A+LKL ++  +K  RL  +RYD KT  +TI
Sbjct: 190 PISIEYSTYIHQGTSIRDIRSRVVTMKIHVAELKLSENQMEKLIRLAANRYDEKTGKMTI 249

Query: 691 HSGFVVQLKYKTLDYVH 741
            +      + + LDY H
Sbjct: 250 ITD-RCHTRQQNLDYAH 265


>AC084159-15|AAK39353.1|  418|Caenorhabditis elegans Hypothetical
           protein Y73B3A.13 protein.
          Length = 418

 Score = 28.3 bits (60), Expect = 7.5
 Identities = 21/79 (26%), Positives = 38/79 (48%), Gaps = 5/79 (6%)
 Frame = +3

Query: 150 EEEFRVLDILKKRDKMQRRV-VKRTDVQPDRIDRM----AQTRTGGMCGLVRKLSTRLRC 314
           E +  V    K RD M+RR+ ++   V+   I       ++TRTG   G   K+  R R 
Sbjct: 136 EHQAHVGPFKKLRDAMRRRIEMRECGVRLMMIKTWTTTCSKTRTGEQFGANSKIIFRWRL 195

Query: 315 HYRYVRATYQRVKHRQVKK 371
           H+  +   +Q ++  Q+++
Sbjct: 196 HFNDLPRAFQPIRVAQIER 214


>Z78542-7|CAB01750.1|  300|Caenorhabditis elegans Hypothetical
           protein F20D1.9 protein.
          Length = 300

 Score = 27.9 bits (59), Expect = 9.9
 Identities = 32/113 (28%), Positives = 47/113 (41%), Gaps = 4/113 (3%)
 Frame = -2

Query: 401 NLVFSLILHSLFYLAVLDPLV-RSPDVSVMAPKTGGKFSDQATHSPSSGLGHPVDPIWLH 225
           ++ FS+I   LF  A LD L  R PD S  A   G   +   + + SS    P+D I   
Sbjct: 172 DVTFSVIYFPLF--AYLDSLAPRKPDGSGDAVFYGSFLAGLTSGAASSFCVTPLDVIKTR 229

Query: 224 ISSFDYSTLHFI-PFLQDI*YT--KXXXXFALFQSGICRSRV*TP*FNVAGAI 75
           + + +      +   + D   T  K     ALF+   CR  V  P F +A  +
Sbjct: 230 MQTINKGANEIVYKNIPDAFVTIFKNEGPKALFKGAACRMMVMAPLFGIAQTV 282


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 19,691,338
Number of Sequences: 27780
Number of extensions: 427435
Number of successful extensions: 1158
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 1115
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1157
length of database: 12,740,198
effective HSP length: 81
effective length of database: 10,490,018
effective search space used: 2160943708
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -