SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30152.Seq
         (877 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF067219-16|AAC17022.1|  531|Caenorhabditis elegans Hypothetical...    54   2e-07
DQ338465-1|ABC67522.1|  690|Caenorhabditis elegans KEL-8 protein.      42   4e-04
AF067946-5|AAC17684.4|  690|Caenorhabditis elegans Hypothetical ...    42   4e-04
Z69902-7|CAA93769.1|  618|Caenorhabditis elegans Hypothetical pr...    39   0.005
AB023424-1|BAA82800.1|  618|Caenorhabditis elegans kel-1 protein.      39   0.005
Z82059-10|CAB04878.2|  589|Caenorhabditis elegans Hypothetical p...    37   0.022
AF016430-5|AAB65373.1|  581|Caenorhabditis elegans Hypothetical ...    34   0.12 
Z70686-2|CAA94610.1|  570|Caenorhabditis elegans Hypothetical pr...    34   0.15 
U20142-2|AAB60235.1|  570|Caenorhabditis elegans SPE-26 protein ...    34   0.15 
AF024501-8|AAN65318.1|  550|Caenorhabditis elegans Hypothetical ...    33   0.20 
Z82059-11|CAC42351.2|  591|Caenorhabditis elegans Hypothetical p...    33   0.27 
AL021176-3|CAA15976.2|  316|Caenorhabditis elegans Hypothetical ...    32   0.47 
Z68009-3|CAA92005.1|  817|Caenorhabditis elegans Hypothetical pr...    32   0.62 
AF519108-1|AAM74222.1|  909|Caenorhabditis elegans EOR-1 protein.      31   1.1  
AF502568-1|AAM74151.1|  909|Caenorhabditis elegans EOR-1 protein.      31   1.1  
AF100669-8|AAK39268.1|  909|Caenorhabditis elegans Egl-1 suppres...    31   1.1  
U00032-10|AAA50637.1|  418|Caenorhabditis elegans Hypothetical p...    29   4.4  
Z66512-2|CAA91323.1|  387|Caenorhabditis elegans Hypothetical pr...    29   5.8  
Z92782-12|CAH60765.1|  328|Caenorhabditis elegans Hypothetical p...    28   7.6  
U97003-3|AAB52269.1|  166|Caenorhabditis elegans Hypothetical pr...    28   7.6  

>AF067219-16|AAC17022.1|  531|Caenorhabditis elegans Hypothetical
           protein R12E2.1 protein.
          Length = 531

 Score = 53.6 bits (123), Expect = 2e-07
 Identities = 27/68 (39%), Positives = 40/68 (58%)
 Frame = +2

Query: 524 CCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLPLDELN 703
           CCD+L+  L+P NCLGI  FA    C +L + A  + L+ F  V  + +EF  L ++ L 
Sbjct: 145 CCDYLKKQLDPSNCLGIRAFADTHSCKELLSSADEFALKNFSRVIGK-EEFQMLTVESLT 203

Query: 704 SIILEDEL 727
           +II  D+L
Sbjct: 204 TIIKSDKL 211



 Score = 41.9 bits (94), Expect = 6e-04
 Identities = 21/71 (29%), Positives = 34/71 (47%)
 Frame = +3

Query: 300 HRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXXXXXXIDVTDTNVHEL 479
           HR +LSACSPYFL++FT+ +      ++ +  +                I + D+NV ++
Sbjct: 70  HRVVLSACSPYFLSMFTSQMAECYMREINMEEIEPPTLEALIEFCYTGAIAIDDSNVQDI 129

Query: 480 LMTADYLAFLE 512
           L  A  L   E
Sbjct: 130 LPAACLLQIHE 140


>DQ338465-1|ABC67522.1|  690|Caenorhabditis elegans KEL-8 protein.
          Length = 690

 Score = 42.3 bits (95), Expect = 4e-04
 Identities = 26/93 (27%), Positives = 41/93 (44%), Gaps = 4/93 (4%)
 Frame = +3

Query: 282 GASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXXXXXXIDVTD 461
           G+    HR IL+A SPYF A+FT  +   ++  + +  +                I +T 
Sbjct: 119 GSVIRAHRYILAAASPYFKAMFTNGMVEMKKLTIELQDIPEESVRIIVDYIYTDKIAITM 178

Query: 462 TNVHELLMTADYLAF----LECFSFVAIISEVH 548
            NVH+L+ TA  L      + C  F+A +   H
Sbjct: 179 NNVHQLIFTATVLQMDVIVVACQQFLATMITSH 211


>AF067946-5|AAC17684.4|  690|Caenorhabditis elegans Hypothetical
           protein W02G9.2 protein.
          Length = 690

 Score = 42.3 bits (95), Expect = 4e-04
 Identities = 26/93 (27%), Positives = 41/93 (44%), Gaps = 4/93 (4%)
 Frame = +3

Query: 282 GASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXXXXXXIDVTD 461
           G+    HR IL+A SPYF A+FT  +   ++  + +  +                I +T 
Sbjct: 119 GSVIRAHRYILAAASPYFKAMFTNGMVEMKKLTIELQDIPEESVRIIVDYIYTDKIAITM 178

Query: 462 TNVHELLMTADYLAF----LECFSFVAIISEVH 548
            NVH+L+ TA  L      + C  F+A +   H
Sbjct: 179 NNVHQLIFTATVLQMDVIVVACQQFLATMITSH 211


>Z69902-7|CAA93769.1|  618|Caenorhabditis elegans Hypothetical
           protein C47D12.7 protein.
          Length = 618

 Score = 38.7 bits (86), Expect = 0.005
 Identities = 21/72 (29%), Positives = 36/72 (50%)
 Frame = +2

Query: 512 VLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLPL 691
           V   C   +   L+  NC+G+  FAR   C++L   A+ Y  ++FV +   ++E L L  
Sbjct: 156 VRDACARFMLELLDMTNCVGMAEFARAHACHQLAHAAQLYTRQHFVEI-IDNEELLSLDK 214

Query: 692 DELNSIILEDEL 727
           D    +I +D +
Sbjct: 215 DAFCELIQDDRI 226



 Score = 33.9 bits (74), Expect = 0.15
 Identities = 22/67 (32%), Positives = 28/67 (41%)
 Frame = +3

Query: 300 HRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXXXXXXIDVTDTNVHEL 479
           HR ILSA S YF A+FT  L    Q  + I  V                + + + NV  +
Sbjct: 85  HRVILSASSSYFRAMFTGGLRESTQRIIPIKEVDVEVLSQLIDYMYTGRMRIDEQNVQTI 144

Query: 480 LMTADYL 500
           L TA  L
Sbjct: 145 LATASLL 151


>AB023424-1|BAA82800.1|  618|Caenorhabditis elegans kel-1 protein.
          Length = 618

 Score = 38.7 bits (86), Expect = 0.005
 Identities = 21/72 (29%), Positives = 36/72 (50%)
 Frame = +2

Query: 512 VLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLPL 691
           V   C   +   L+  NC+G+  FAR   C++L   A+ Y  ++FV +   ++E L L  
Sbjct: 156 VRDACARFMLELLDMTNCVGMAEFARAHACHQLAHAAQLYTRQHFVEI-IDNEELLSLDK 214

Query: 692 DELNSIILEDEL 727
           D    +I +D +
Sbjct: 215 DAFCELIQDDRI 226



 Score = 33.9 bits (74), Expect = 0.15
 Identities = 22/67 (32%), Positives = 28/67 (41%)
 Frame = +3

Query: 300 HRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXXXXXXIDVTDTNVHEL 479
           HR ILSA S YF A+FT  L    Q  + I  V                + + + NV  +
Sbjct: 85  HRVILSASSSYFRAMFTGGLRESTQRIIPIKEVDVEVLSQLIDYMYTGRMRIDEQNVQTI 144

Query: 480 LMTADYL 500
           L TA  L
Sbjct: 145 LATASLL 151


>Z82059-10|CAB04878.2|  589|Caenorhabditis elegans Hypothetical
           protein T27E9.4a protein.
          Length = 589

 Score = 36.7 bits (81), Expect = 0.022
 Identities = 19/86 (22%), Positives = 36/86 (41%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXX 434
           CD  +  ++      H+ IL+A  PYF  +FT  L      ++ I  +            
Sbjct: 51  CDVALLVEN-RKLSAHKVILAATIPYFRGMFTLDLMEANMKEINIEDMNYETVDALLSFA 109

Query: 435 XXXXIDVTDTNVHELLMTADYLAFLE 512
               + +T +NV  +++ A++   LE
Sbjct: 110 YTGELRITTSNVQSIMLGANFFQMLE 135


>AF016430-5|AAB65373.1|  581|Caenorhabditis elegans Hypothetical
           protein C05C8.6 protein.
          Length = 581

 Score = 34.3 bits (75), Expect = 0.12
 Identities = 26/114 (22%), Positives = 44/114 (38%)
 Frame = +3

Query: 258 DAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXXX 437
           D  +  DDG  F  HR IL+  S +F A+  T      Q  V +    S           
Sbjct: 65  DVTLVLDDGTEFAAHRLILAVRSSFFRAMLYTGFQESHQQLVTLQETNSVAFRAVLRYMY 124

Query: 438 XXXIDVTDTNVHELLMTADYLAFLECFSFVAIISEVH*TQKTVLEL*LLQGVFS 599
              ID     +  LL   +YL+    +  + +++ +    K +L+   L  +F+
Sbjct: 125 TSKIDFAGVELDILL---EYLSLAHRYDLIQLMTAISEYFKEILKNENLCSIFN 175


>Z70686-2|CAA94610.1|  570|Caenorhabditis elegans Hypothetical
           protein R10H10.2 protein.
          Length = 570

 Score = 33.9 bits (74), Expect = 0.15
 Identities = 23/82 (28%), Positives = 39/82 (47%), Gaps = 7/82 (8%)
 Frame = +2

Query: 503 FPGVLQL---CCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYL---LRYFVTVATQ 664
           FP +L++    CDH+ S+L+  NC  +    R   C         Y+   L   V V  +
Sbjct: 100 FPKILEMKNTICDHILSTLSDVNCFLLHKKFREFDCQNHAHKTLEYILYNLARMVVVDKR 159

Query: 665 SD-EFLHLPLDELNSIILEDEL 727
            D EF  LP++E+  ++  +E+
Sbjct: 160 VDVEFYRLPVEEVKHLLSSEEV 181


>U20142-2|AAB60235.1|  570|Caenorhabditis elegans SPE-26 protein
           protein.
          Length = 570

 Score = 33.9 bits (74), Expect = 0.15
 Identities = 23/82 (28%), Positives = 39/82 (47%), Gaps = 7/82 (8%)
 Frame = +2

Query: 503 FPGVLQL---CCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYL---LRYFVTVATQ 664
           FP +L++    CDH+ S+L+  NC  +    R   C         Y+   L   V V  +
Sbjct: 100 FPKILEMKNTICDHILSTLSDVNCFLLHKKFREFDCQNHAHKTLEYILYNLARMVVVDKR 159

Query: 665 SD-EFLHLPLDELNSIILEDEL 727
            D EF  LP++E+  ++  +E+
Sbjct: 160 VDVEFYRLPVEEVKHLLSSEEV 181


>AF024501-8|AAN65318.1|  550|Caenorhabditis elegans Hypothetical
           protein F39E9.12 protein.
          Length = 550

 Score = 33.5 bits (73), Expect = 0.20
 Identities = 20/66 (30%), Positives = 32/66 (48%)
 Frame = +3

Query: 297 VHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXXXXXXIDVTDTNVHE 476
           V++A LS  S YF ALF+++    EQ+++ +  V                +  TD  V +
Sbjct: 405 VNKAFLSYHSDYFRALFSSSFKENEQNEIELKDVVYGDFELLMSTIYPKPVFPTDRTVKK 464

Query: 477 LLMTAD 494
           LL+ AD
Sbjct: 465 LLVMAD 470


>Z82059-11|CAC42351.2|  591|Caenorhabditis elegans Hypothetical
           protein T27E9.4b protein.
          Length = 591

 Score = 33.1 bits (72), Expect = 0.27
 Identities = 20/88 (22%), Positives = 37/88 (42%), Gaps = 2/88 (2%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLI--SGVRSXXXXXXXX 428
           CD  +  ++      H+ IL+A  PYF  +FT  L      ++ I  S +          
Sbjct: 51  CDVALLVEN-RKLSAHKVILAATIPYFRGMFTLDLMEANMKEINIEDSDMNYETVDALLS 109

Query: 429 XXXXXXIDVTDTNVHELLMTADYLAFLE 512
                 + +T +NV  +++ A++   LE
Sbjct: 110 FAYTGELRITTSNVQSIMLGANFFQMLE 137


>AL021176-3|CAA15976.2|  316|Caenorhabditis elegans Hypothetical
           protein Y43E12A.3 protein.
          Length = 316

 Score = 32.3 bits (70), Expect = 0.47
 Identities = 18/37 (48%), Positives = 19/37 (51%)
 Frame = +3

Query: 258 DAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSR 368
           D IV  D G  F V+R ILS  SP FL  F T    R
Sbjct: 153 DTIVLVD-GVKFHVNRMILSMASPIFLEAFVTNFDER 188


>Z68009-3|CAA92005.1|  817|Caenorhabditis elegans Hypothetical
           protein R09A8.3 protein.
          Length = 817

 Score = 31.9 bits (69), Expect = 0.62
 Identities = 18/73 (24%), Positives = 35/73 (47%)
 Frame = +2

Query: 512 VLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLPL 691
           V++ C  +L  +L   NC+GI   A       L     ++++  F ++   S EF  LP+
Sbjct: 221 VIRACAAYLAENLQLSNCIGIRRQANFHNDTFLMGKVDQFIVDNFDSIVNDSKEFTQLPV 280

Query: 692 DELNSIILEDELK 730
            ++  I+  ++ K
Sbjct: 281 IQVRIIVPAEDGK 293


>AF519108-1|AAM74222.1|  909|Caenorhabditis elegans EOR-1 protein.
          Length = 909

 Score = 31.1 bits (67), Expect = 1.1
 Identities = 17/40 (42%), Positives = 23/40 (57%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQ 374
           CD  +   +  SF  HR IL+A SPYF A+F     ++EQ
Sbjct: 42  CDVEIVVQN-KSFAAHRNILAAHSPYFDAIFKYCKITKEQ 80


>AF502568-1|AAM74151.1|  909|Caenorhabditis elegans EOR-1 protein.
          Length = 909

 Score = 31.1 bits (67), Expect = 1.1
 Identities = 17/40 (42%), Positives = 23/40 (57%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQ 374
           CD  +   +  SF  HR IL+A SPYF A+F     ++EQ
Sbjct: 42  CDVEIVVQN-KSFAAHRNILAAHSPYFDAIFKYCKITKEQ 80


>AF100669-8|AAK39268.1|  909|Caenorhabditis elegans Egl-1
           suppressor/dio uptake defective/raf enhancer protein 1
           protein.
          Length = 909

 Score = 31.1 bits (67), Expect = 1.1
 Identities = 17/40 (42%), Positives = 23/40 (57%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQ 374
           CD  +   +  SF  HR IL+A SPYF A+F     ++EQ
Sbjct: 42  CDVEIVVQN-KSFAAHRNILAAHSPYFDAIFKYCKITKEQ 80


>U00032-10|AAA50637.1|  418|Caenorhabditis elegans Hypothetical
           protein F37A4.9 protein.
          Length = 418

 Score = 29.1 bits (62), Expect = 4.4
 Identities = 14/29 (48%), Positives = 16/29 (55%)
 Frame = +3

Query: 258 DAIVRADDGASFPVHRAILSACSPYFLAL 344
           D I+ A  G  FP H  IL+A S YF  L
Sbjct: 233 DFIIVASCGREFPTHMCILAARSEYFKVL 261


>Z66512-2|CAA91323.1|  387|Caenorhabditis elegans Hypothetical
           protein F52H3.3 protein.
          Length = 387

 Score = 28.7 bits (61), Expect = 5.8
 Identities = 22/86 (25%), Positives = 35/86 (40%)
 Frame = +3

Query: 237 ARVSSACDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXX 416
           A  ++ CD  +  +    F V++A L+  SP F A+F +    RE++ V +  V      
Sbjct: 222 AMQTNICDMTLVINKQKLF-VNKAYLALYSPVFYAMFFSNFQEREKTQVELEDVVLEEFR 280

Query: 417 XXXXXXXXXXIDVTDTNVHELLMTAD 494
                       +T  NV  LL   D
Sbjct: 281 ELLHVIYPCHKPITSDNVEYLLELGD 306


>Z92782-12|CAH60765.1|  328|Caenorhabditis elegans Hypothetical
           protein F14F8.13 protein.
          Length = 328

 Score = 28.3 bits (60), Expect = 7.6
 Identities = 14/38 (36%), Positives = 21/38 (55%), Gaps = 3/38 (7%)
 Frame = +3

Query: 459 DTNVHELLMT---ADYLAFLECFSFVAIISEVH*TQKT 563
           D + H+L +    +DY  F+ CFSF  I   +H  Q+T
Sbjct: 82  DDSSHQLALNNTVSDYFIFIYCFSFFIIFYILHVLQQT 119


>U97003-3|AAB52269.1|  166|Caenorhabditis elegans Hypothetical
           protein F47C10.2 protein.
          Length = 166

 Score = 28.3 bits (60), Expect = 7.6
 Identities = 22/79 (27%), Positives = 34/79 (43%)
 Frame = +3

Query: 258 DAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXXX 437
           DAI+   D     V++A LS  S YF ALF++     + S++ +  V             
Sbjct: 9   DAILVIGD-KMLNVNKAFLSFHSTYFSALFSSNYKEGQMSEIELKDVSYENFALLLGTIY 67

Query: 438 XXXIDVTDTNVHELLMTAD 494
              I   D  V+++L  AD
Sbjct: 68  PNTIFPNDKTVYKILDMAD 86


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 19,667,605
Number of Sequences: 27780
Number of extensions: 420203
Number of successful extensions: 1184
Number of sequences better than 10.0: 20
Number of HSP's better than 10.0 without gapping: 1128
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1183
length of database: 12,740,198
effective HSP length: 81
effective length of database: 10,490,018
effective search space used: 2202903780
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -