SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30149.Seq
         (867 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z46241-4|CAA86318.1|  837|Caenorhabditis elegans Hypothetical pr...    30   2.5  
U39744-3|AAK18884.2|  563|Caenorhabditis elegans Hypothetical pr...    29   3.3  
AF068713-6|AAC17797.1|  282|Caenorhabditis elegans Serpentine re...    29   3.3  
U40937-1|AAA81693.1|  396|Caenorhabditis elegans Collagen protei...    28   7.5  
Z77134-2|CAB00873.1|  877|Caenorhabditis elegans Hypothetical pr...    28   9.9  

>Z46241-4|CAA86318.1|  837|Caenorhabditis elegans Hypothetical
           protein C38D4.5 protein.
          Length = 837

 Score = 29.9 bits (64), Expect = 2.5
 Identities = 16/57 (28%), Positives = 27/57 (47%)
 Frame = +3

Query: 3   NQKNRFKIFSNYMKK*INKNTRFIKLFLLSVRMHRSHASKNQINNMRPMILEDRTAF 173
           N   RFK F   + +  N+N   +K+ L  +    SH+S+N++      I+   T F
Sbjct: 710 NATTRFKKFEELLSRLPNENRETLKMLLRHLNRVASHSSQNRMQQHNLAIVFGPTLF 766


>U39744-3|AAK18884.2|  563|Caenorhabditis elegans Hypothetical
           protein C03F11.3 protein.
          Length = 563

 Score = 29.5 bits (63), Expect = 3.3
 Identities = 15/43 (34%), Positives = 28/43 (65%), Gaps = 1/43 (2%)
 Frame = -3

Query: 517 LCDV-AGVLWVVSQELNIVHGLVQDTFISENVINNRINETHFL 392
           +C V AG+++++   L +V GLV    +  N++NN+IN++  L
Sbjct: 7   ICQVSAGIIFLIGAAL-LVAGLVIVLNVFPNIVNNQINDSKVL 48


>AF068713-6|AAC17797.1|  282|Caenorhabditis elegans Serpentine
           receptor, class bc (class b-like) protein 67 protein.
          Length = 282

 Score = 29.5 bits (63), Expect = 3.3
 Identities = 20/73 (27%), Positives = 36/73 (49%)
 Frame = -3

Query: 583 VLALPLVWPPSDVSLTPSGIAKLCDVAGVLWVVSQELNIVHGLVQDTFISENVINNRINE 404
           +  L  +   SD+SL  S  A   D+     ++  +L ++ G++  TFI +N+I   I  
Sbjct: 30  IFCLKGITSKSDMSLVYSRFA--ADIGYSCSIIVFKLYVLAGMISKTFILKNIIFFVIRA 87

Query: 403 THFLFVLEIDLLW 365
           T  L ++   LL+
Sbjct: 88  TVILGIIRTSLLF 100


>U40937-1|AAA81693.1|  396|Caenorhabditis elegans Collagen protein
           164 protein.
          Length = 396

 Score = 28.3 bits (60), Expect = 7.5
 Identities = 20/55 (36%), Positives = 27/55 (49%), Gaps = 2/55 (3%)
 Frame = +1

Query: 589 TQLLEGAGQPFKEMENVVWETKSTLRSCHR--*DSYKKXGSLVVGPIAATLREGT 747
           T  LE A   F+E  NV+W+   T  S  R    +YK+ G+   G  AAT  E +
Sbjct: 42  TAQLETAKTGFEETSNVLWKELVTNESHRRVARQTYKEGGAAGEGSPAATAPEAS 96


>Z77134-2|CAB00873.1|  877|Caenorhabditis elegans Hypothetical
           protein R09H10.4 protein.
          Length = 877

 Score = 27.9 bits (59), Expect = 9.9
 Identities = 12/37 (32%), Positives = 19/37 (51%)
 Frame = -1

Query: 756 LIMRSLTQCGGNRSDNERAXFFIRILAMAAAKCTLCF 646
           L+ R   QCG   +DN++A   + +L  A     +CF
Sbjct: 15  LLNRLFRQCGLFVADNDKAVLIVTLLLTAFCSSKICF 51


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 18,977,666
Number of Sequences: 27780
Number of extensions: 390976
Number of successful extensions: 1019
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 972
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1019
length of database: 12,740,198
effective HSP length: 81
effective length of database: 10,490,018
effective search space used: 2171433726
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -