SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30148.Seq
         (812 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U39999-14|ABF71722.1| 1483|Caenorhabditis elegans Hypothetical p...    34   0.11 
AM773423-1|CAO78927.1| 1473|Caenorhabditis elegans AGRin (synapt...    32   0.56 
U28735-10|AAM69112.1| 2427|Caenorhabditis elegans Hypothetical p...    31   0.98 
U28735-9|AAM69113.1| 1299|Caenorhabditis elegans Hypothetical pr...    31   0.98 
CU457741-17|CAM36359.1|  300|Caenorhabditis elegans Hypothetical...    30   2.3  
AL033536-1|CAA22138.1|  908|Caenorhabditis elegans Hypothetical ...    28   6.9  
Z81579-4|CAE17915.1|  212|Caenorhabditis elegans Hypothetical pr...    28   9.1  
Z75952-5|CAB00093.2|  149|Caenorhabditis elegans Hypothetical pr...    28   9.1  
Z47812-9|CAA87794.2|  377|Caenorhabditis elegans Hypothetical pr...    28   9.1  

>U39999-14|ABF71722.1| 1483|Caenorhabditis elegans Hypothetical
           protein F41G3.12 protein.
          Length = 1483

 Score = 34.3 bits (75), Expect = 0.11
 Identities = 10/19 (52%), Positives = 15/19 (78%)
 Frame = -2

Query: 604 SCYFGSSCHSGACVCRGCS 548
           +CYFG++CH+ AC C  C+
Sbjct: 669 ACYFGATCHNWACTCPTCN 687



 Score = 31.9 bits (69), Expect = 0.56
 Identities = 10/19 (52%), Positives = 11/19 (57%)
 Frame = -2

Query: 616 CLRFSCYFGSSCHSGACVC 560
           CL   C +G  C SG CVC
Sbjct: 587 CLHVQCRYGEECRSGVCVC 605


>AM773423-1|CAO78927.1| 1473|Caenorhabditis elegans AGRin (synaptic
           protein) homologfamily member protein.
          Length = 1473

 Score = 31.9 bits (69), Expect = 0.56
 Identities = 10/19 (52%), Positives = 11/19 (57%)
 Frame = -2

Query: 616 CLRFSCYFGSSCHSGACVC 560
           CL   C +G  C SG CVC
Sbjct: 595 CLHVQCRYGEECRSGVCVC 613


>U28735-10|AAM69112.1| 2427|Caenorhabditis elegans Hypothetical
           protein F48E3.8a protein.
          Length = 2427

 Score = 31.1 bits (67), Expect = 0.98
 Identities = 15/40 (37%), Positives = 20/40 (50%), Gaps = 6/40 (15%)
 Frame = -2

Query: 661 PASLVEFSGRFLFR------CCLRFSCYFGSSCHSGACVC 560
           P+ +VE +GR + +      C     C FGS C SG C C
Sbjct: 288 PSGIVEVAGRCVKQVSIGQPCVANAQCNFGSFCQSGTCQC 327


>U28735-9|AAM69113.1| 1299|Caenorhabditis elegans Hypothetical
           protein F48E3.8b protein.
          Length = 1299

 Score = 31.1 bits (67), Expect = 0.98
 Identities = 15/40 (37%), Positives = 20/40 (50%), Gaps = 6/40 (15%)
 Frame = -2

Query: 661 PASLVEFSGRFLFR------CCLRFSCYFGSSCHSGACVC 560
           P+ +VE +GR + +      C     C FGS C SG C C
Sbjct: 288 PSGIVEVAGRCVKQVSIGQPCVANAQCNFGSFCQSGTCQC 327


>CU457741-17|CAM36359.1|  300|Caenorhabditis elegans Hypothetical
           protein C42C1.16 protein.
          Length = 300

 Score = 29.9 bits (64), Expect = 2.3
 Identities = 15/54 (27%), Positives = 29/54 (53%)
 Frame = -1

Query: 398 SVSEVRSGNKVSVCLSRIKFHCNSGLDVVIIVYLLNLLRINVPLRKYLFRASLT 237
           SV  + +G+ ++  ++   FH  + L V  IV++L++  + +PLR   F    T
Sbjct: 246 SVGSIFAGSPLAHLIATFSFHVFTILFVTQIVFVLSISSLQIPLRMEAFSEKKT 299


>AL033536-1|CAA22138.1|  908|Caenorhabditis elegans Hypothetical
           protein Y53C10A.4 protein.
          Length = 908

 Score = 28.3 bits (60), Expect = 6.9
 Identities = 12/38 (31%), Positives = 21/38 (55%)
 Frame = +3

Query: 381 PYFRNRIEDQITESYRPTRSPATTVPSAYDDPDPQLYF 494
           P F++     +TE Y+ + S +++  S   DP P+ YF
Sbjct: 689 PAFKSSSVAMLTEPYKSSSSSSSSTSSIPSDPAPRPYF 726


>Z81579-4|CAE17915.1|  212|Caenorhabditis elegans Hypothetical
           protein R13H4.8 protein.
          Length = 212

 Score = 27.9 bits (59), Expect = 9.1
 Identities = 16/34 (47%), Positives = 16/34 (47%)
 Frame = -2

Query: 619 CCLRFSCYFGSSCHSGACVCRGCSGYGGF*RRSL 518
           CC    C  G  C  G C   GC G GG  RRSL
Sbjct: 115 CCRPCCCGCGCGCGCGCC---GCGG-GGRKRRSL 144


>Z75952-5|CAB00093.2|  149|Caenorhabditis elegans Hypothetical
           protein F29D10.2 protein.
          Length = 149

 Score = 27.9 bits (59), Expect = 9.1
 Identities = 16/34 (47%), Positives = 16/34 (47%)
 Frame = -2

Query: 619 CCLRFSCYFGSSCHSGACVCRGCSGYGGF*RRSL 518
           CC    C  G  C  G C   GC G GG  RRSL
Sbjct: 97  CCRPCCCGCGCGCGCGCC---GCGG-GGRKRRSL 126


>Z47812-9|CAA87794.2|  377|Caenorhabditis elegans Hypothetical
           protein T05H10.8 protein.
          Length = 377

 Score = 27.9 bits (59), Expect = 9.1
 Identities = 13/38 (34%), Positives = 23/38 (60%), Gaps = 1/38 (2%)
 Frame = +3

Query: 348 TGQAYRD-FVAGPYFRNRIEDQITESYRPTRSPATTVP 458
           +G+A R+ F A   F   I+D++ ++  P +S  TT+P
Sbjct: 112 SGKALRESFEAWDIFLREIDDELEKTLGPVKSAVTTLP 149


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 16,455,490
Number of Sequences: 27780
Number of extensions: 314906
Number of successful extensions: 1171
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 1060
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1166
length of database: 12,740,198
effective HSP length: 80
effective length of database: 10,517,798
effective search space used: 1998381620
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -