SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30147.Seq
         (878 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U51994-6|AAA96068.1|  463|Caenorhabditis elegans Elongation fact...   266   2e-71
U40935-2|AAA81688.1|  463|Caenorhabditis elegans Elongation fact...   266   2e-71
U51994-7|AAO21384.1|  429|Caenorhabditis elegans Elongation fact...   146   2e-49
U51994-9|AAO21383.1|  267|Caenorhabditis elegans Elongation fact...   155   4e-38
U51994-8|AAO21382.1|   77|Caenorhabditis elegans Elongation fact...   138   4e-33
Z81098-7|CAI79193.2|  592|Caenorhabditis elegans Hypothetical pr...   134   6e-32
Z81098-6|CAB03180.3|  610|Caenorhabditis elegans Hypothetical pr...   134   6e-32
Z92835-1|CAB07395.2|  532|Caenorhabditis elegans Hypothetical pr...   118   4e-27
U80437-9|AAN84843.1|  439|Caenorhabditis elegans Tu elongation f...    69   3e-12
AB010028-1|BAA31345.1|  439|Caenorhabditis elegans mitochondrial...    69   3e-12
D38472-1|BAA07492.1|  495|Caenorhabditis elegans elongation fact...    67   2e-11
D38471-1|BAA07491.1|  496|Caenorhabditis elegans elongation fact...    67   2e-11
AC024859-25|AAK29979.1|  496|Caenorhabditis elegans Tu elongatio...    67   2e-11
Z99709-7|CAB16862.2|  500|Caenorhabditis elegans Hypothetical pr...    43   3e-04
Z70780-15|CAA94822.2|  702|Caenorhabditis elegans Hypothetical p...    41   0.001
L13200-4|AAA28191.2|  645|Caenorhabditis elegans Hypothetical pr...    35   0.088
AC006714-2|AAK29716.2|  689|Caenorhabditis elegans Hypothetical ...    34   0.12 
DQ867020-1|ABI49097.1| 1074|Caenorhabditis elegans eukaryotic tr...    34   0.15 
AC025716-9|AAK39619.1|  469|Caenorhabditis elegans Hypothetical ...    34   0.15 
AC024817-55|AAF59563.3|  366|Caenorhabditis elegans Hypothetical...    33   0.20 
Z81519-1|CAB04216.1|  750|Caenorhabditis elegans Hypothetical pr...    33   0.27 
Z81068-5|CAB02985.1|  852|Caenorhabditis elegans Hypothetical pr...    33   0.36 
M86959-1|AAD03339.1|  852|Caenorhabditis elegans elongation fact...    33   0.36 
U50193-2|AAA91248.1|  974|Caenorhabditis elegans Elongation fact...    32   0.62 
M86958-1|AAA21824.1|  849|Caenorhabditis elegans eft-1 protein.        32   0.62 
L40996-1|AAA86431.1|  593|Caenorhabditis elegans GTP-binding pro...    31   1.1  
AF125969-2|AAD14761.1|  613|Caenorhabditis elegans Caenorhabditi...    31   1.1  
AL032643-4|CAA21662.1|  436|Caenorhabditis elegans Hypothetical ...    30   1.9  
Z66513-12|CAI46602.1|  492|Caenorhabditis elegans Hypothetical p...    29   3.3  
Z66513-11|CAA91332.3|  427|Caenorhabditis elegans Hypothetical p...    29   3.3  
AC084152-1|AAM69074.2|  332|Caenorhabditis elegans Hypothetical ...    29   4.4  
Z99709-6|CAB16863.1|  459|Caenorhabditis elegans Hypothetical pr...    29   5.8  

>U51994-6|AAA96068.1|  463|Caenorhabditis elegans Elongation factor
           protein 4, isoforma protein.
          Length = 463

 Score =  266 bits (651), Expect = 2e-71
 Identities = 128/195 (65%), Positives = 145/195 (74%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           IDIALWKFET+KYY+TIIDAPGHRDFIKNMITGTSQADCAVL+VA GTGEFEAGISKNGQ
Sbjct: 73  IDIALWKFETAKYYITIIDAPGHRDFIKNMITGTSQADCAVLVVACGTGEFEAGISKNGQ 132

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVP 615
           TREHALLA TLGVKQLIV  NKMDS           +   +     +++GYNP AV FVP
Sbjct: 133 TREHALLAQTLGVKQLIVACNKMDSTEPPFSEARFTEITNEVSGFIKKIGYNPKAVPFVP 192

Query: 616 ISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDAILPPARPLTSPCVFPARR 795
           ISG++GDNMLE S+ MPWFKGW VERKEG A GK L+EALD+I+PP RP   P   P + 
Sbjct: 193 ISGFNGDNMLEVSSNMPWFKGWAVERKEGNASGKTLLEALDSIIPPQRPTDRPLRLPLQD 252

Query: 796 IXNSVVXVPCPSGRI 840
           +         P GR+
Sbjct: 253 VYKIGGIGTVPVGRV 267



 Score =  146 bits (353), Expect = 2e-35
 Identities = 67/68 (98%), Positives = 67/68 (98%)
 Frame = +3

Query: 42  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 221
           MGKEK HINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL
Sbjct: 1   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 60

Query: 222 DKLKAERE 245
           DKLKAERE
Sbjct: 61  DKLKAERE 68


>U40935-2|AAA81688.1|  463|Caenorhabditis elegans Elongation factor
           protein 3 protein.
          Length = 463

 Score =  266 bits (651), Expect = 2e-71
 Identities = 128/195 (65%), Positives = 145/195 (74%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           IDIALWKFET+KYY+TIIDAPGHRDFIKNMITGTSQADCAVL+VA GTGEFEAGISKNGQ
Sbjct: 73  IDIALWKFETAKYYITIIDAPGHRDFIKNMITGTSQADCAVLVVACGTGEFEAGISKNGQ 132

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVP 615
           TREHALLA TLGVKQLIV  NKMDS           +   +     +++GYNP AV FVP
Sbjct: 133 TREHALLAQTLGVKQLIVACNKMDSTEPPFSEARFTEITNEVSGFIKKIGYNPKAVPFVP 192

Query: 616 ISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDAILPPARPLTSPCVFPARR 795
           ISG++GDNMLE S+ MPWFKGW VERKEG A GK L+EALD+I+PP RP   P   P + 
Sbjct: 193 ISGFNGDNMLEVSSNMPWFKGWAVERKEGNASGKTLLEALDSIIPPQRPTDRPLRLPLQD 252

Query: 796 IXNSVVXVPCPSGRI 840
           +         P GR+
Sbjct: 253 VYKIGGIGTVPVGRV 267



 Score =  146 bits (353), Expect = 2e-35
 Identities = 67/68 (98%), Positives = 67/68 (98%)
 Frame = +3

Query: 42  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 221
           MGKEK HINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL
Sbjct: 1   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 60

Query: 222 DKLKAERE 245
           DKLKAERE
Sbjct: 61  DKLKAERE 68


>U51994-7|AAO21384.1|  429|Caenorhabditis elegans Elongation factor
           protein 4, isoformd protein.
          Length = 429

 Score =  146 bits (353), Expect = 2e-35
 Identities = 67/68 (98%), Positives = 67/68 (98%)
 Frame = +3

Query: 42  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 221
           MGKEK HINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL
Sbjct: 1   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 60

Query: 222 DKLKAERE 245
           DKLKAERE
Sbjct: 61  DKLKAERE 68



 Score =  118 bits (283), Expect(2) = 2e-49
 Identities = 57/120 (47%), Positives = 72/120 (60%)
 Frame = +1

Query: 481 LIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVPISGWHGDNMLEPSTK 660
           L+V  NKMDS           +   +     +++GYNP AV FVPISG++GDNMLE S+ 
Sbjct: 114 LVVACNKMDSTEPPFSEARFTEITNEVSGFIKKIGYNPKAVPFVPISGFNGDNMLEVSSN 173

Query: 661 MPWFKGWQVERKEGKADGKCLIEALDAILPPARPLTSPCVFPARRIXNSVVXVPCPSGRI 840
           MPWFKGW VERKEG A GK L+EALD+I+PP RP   P   P + +         P GR+
Sbjct: 174 MPWFKGWAVERKEGNASGKTLLEALDSIIPPQRPTDRPLRLPLQDVYKIGGIGTVPVGRV 233



 Score = 96.3 bits (229), Expect(2) = 2e-49
 Identities = 42/45 (93%), Positives = 45/45 (100%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVA 390
           IDIALWKFET+KYY+TIIDAPGHRDFIKNMITGTSQADCAVL+VA
Sbjct: 73  IDIALWKFETAKYYITIIDAPGHRDFIKNMITGTSQADCAVLVVA 117


>U51994-9|AAO21383.1|  267|Caenorhabditis elegans Elongation factor
           protein 4, isoformc protein.
          Length = 267

 Score =  155 bits (376), Expect = 4e-38
 Identities = 80/100 (80%), Positives = 84/100 (84%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           IDIALWKFET+KYY+TIIDAPGHRDFIKNMITGTSQADCAVL+VA GTGEFEAGISKNGQ
Sbjct: 73  IDIALWKFETAKYYITIIDAPGHRDFIKNMITGTSQADCAVLVVACGTGEFEAGISKNGQ 132

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRR 555
           TREHALLA TLGVKQL+       SL   T SPD   SRR
Sbjct: 133 TREHALLAQTLGVKQLV-------SLRSPTRSPD--SSRR 163



 Score =  146 bits (353), Expect = 2e-35
 Identities = 67/68 (98%), Positives = 67/68 (98%)
 Frame = +3

Query: 42  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 221
           MGKEK HINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL
Sbjct: 1   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 60

Query: 222 DKLKAERE 245
           DKLKAERE
Sbjct: 61  DKLKAERE 68



 Score = 41.9 bits (94), Expect = 6e-04
 Identities = 21/43 (48%), Positives = 23/43 (53%)
 Frame = +2

Query: 623 DGTETTCWSLQPKCLGSRDGRWSVRKAKLTENASLKLSMPSCH 751
           D TETTC      C GSRDG  + RK  L E  S +L  PS H
Sbjct: 178 DSTETTCLRSPRTCHGSRDGLLNARKETLPERPSSRLLTPSSH 220


>U51994-8|AAO21382.1|   77|Caenorhabditis elegans Elongation factor
           protein 4, isoformb protein.
          Length = 77

 Score =  138 bits (335), Expect = 4e-33
 Identities = 63/67 (94%), Positives = 64/67 (95%)
 Frame = +3

Query: 42  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 221
           MGKEK HINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL
Sbjct: 1   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 60

Query: 222 DKLKAER 242
           DKLK  +
Sbjct: 61  DKLKVTK 67


>Z81098-7|CAI79193.2|  592|Caenorhabditis elegans Hypothetical
           protein K07A12.4b protein.
          Length = 592

 Score =  134 bits (325), Expect = 6e-32
 Identities = 74/173 (42%), Positives = 105/173 (60%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           +DI    FETS   + ++DAPGH+DFI NMITGTSQAD A+L+V A TGEFE G    GQ
Sbjct: 236 MDIGRTSFETSHRRIVLLDAPGHKDFISNMITGTSQADAAILVVNATTGEFETGFENGGQ 295

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVP 615
           T+EHALL  +LGV QLIV VNK+D+++      D  K+       +R+ G++     FVP
Sbjct: 296 TKEHALLLRSLGVTQLIVAVNKLDTVDWSQDRFDEIKNNLSV-FLTRQAGFSKP--KFVP 352

Query: 616 ISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDAILPPARPLTSP 774
           +SG+ G+N+++   ++ W+            DG CL+E +D+ + P  P   P
Sbjct: 353 VSGFTGENLIK-RMELDWY------------DGPCLLELIDSFVAPQPPSDGP 392



 Score = 83.0 bits (196), Expect = 3e-16
 Identities = 36/65 (55%), Positives = 48/65 (73%)
 Frame = +3

Query: 51  EKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKL 230
           +K  IN++V+GHVD+GKST  GHL++    +D RTI+KF+ EA   GK SF YAWVLD+ 
Sbjct: 167 DKDLINLIVVGHVDAGKSTLMGHLLHDLEVVDSRTIDKFKHEAARNGKASFAYAWVLDET 226

Query: 231 KAERE 245
           + ERE
Sbjct: 227 EEERE 231


>Z81098-6|CAB03180.3|  610|Caenorhabditis elegans Hypothetical
           protein K07A12.4a protein.
          Length = 610

 Score =  134 bits (325), Expect = 6e-32
 Identities = 74/173 (42%), Positives = 105/173 (60%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           +DI    FETS   + ++DAPGH+DFI NMITGTSQAD A+L+V A TGEFE G    GQ
Sbjct: 254 MDIGRTSFETSHRRIVLLDAPGHKDFISNMITGTSQADAAILVVNATTGEFETGFENGGQ 313

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVP 615
           T+EHALL  +LGV QLIV VNK+D+++      D  K+       +R+ G++     FVP
Sbjct: 314 TKEHALLLRSLGVTQLIVAVNKLDTVDWSQDRFDEIKNNLSV-FLTRQAGFSKP--KFVP 370

Query: 616 ISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDAILPPARPLTSP 774
           +SG+ G+N+++   ++ W+            DG CL+E +D+ + P  P   P
Sbjct: 371 VSGFTGENLIK-RMELDWY------------DGPCLLELIDSFVAPQPPSDGP 410



 Score = 83.0 bits (196), Expect = 3e-16
 Identities = 36/65 (55%), Positives = 48/65 (73%)
 Frame = +3

Query: 51  EKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKL 230
           +K  IN++V+GHVD+GKST  GHL++    +D RTI+KF+ EA   GK SF YAWVLD+ 
Sbjct: 185 DKDLINLIVVGHVDAGKSTLMGHLLHDLEVVDSRTIDKFKHEAARNGKASFAYAWVLDET 244

Query: 231 KAERE 245
           + ERE
Sbjct: 245 EEERE 249


>Z92835-1|CAB07395.2|  532|Caenorhabditis elegans Hypothetical
           protein H19N07.1 protein.
          Length = 532

 Score =  118 bits (285), Expect = 4e-27
 Identities = 65/166 (39%), Positives = 91/166 (54%), Gaps = 1/166 (0%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           +++    FET K + TI+DAPGH+ F+ NMI G +QAD AVL+++A  GEFE G  + GQ
Sbjct: 175 VEVGRAYFETEKRHFTILDAPGHKSFVPNMIVGANQADLAVLVISARRGEFETGFDRGGQ 234

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAA-VAFV 612
           TREH++L  T GVK L++ VNKMD           ++   K     R+LG+NP   + +V
Sbjct: 235 TREHSMLVKTAGVKHLVILVNKMDDPTVKWEEERFKEIEGKLTPFLRKLGFNPKTDITYV 294

Query: 613 PISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDAILP 750
           P SG  G  + +  T       W          G C IE +D +LP
Sbjct: 295 PCSGLTGAFIKDRPTGSE--GNWY--------SGPCFIEFIDVLLP 330



 Score = 79.0 bits (186), Expect = 4e-15
 Identities = 34/67 (50%), Positives = 48/67 (71%)
 Frame = +3

Query: 45  GKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLD 224
           G  K HIN+V +GHVD+GKST  G L++  G +DKRT+EK+E+EA+E G+ S+  +W +D
Sbjct: 104 GTHKEHINMVFVGHVDAGKSTIGGQLMFLTGMVDKRTLEKYEREAKEKGRESWYLSWCMD 163

Query: 225 KLKAERE 245
               ERE
Sbjct: 164 TNDEERE 170


>U80437-9|AAN84843.1|  439|Caenorhabditis elegans Tu elongation
           factor (ef-tu), mitochondrialprotein 2 protein.
          Length = 439

 Score = 69.3 bits (162), Expect = 3e-12
 Identities = 38/84 (45%), Positives = 51/84 (60%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           I++A   +E+     +  D PGH DFIKNMI GTSQ D AVL++AA  G  E       Q
Sbjct: 96  INVAHIGYESPLRRYSHTDCPGHSDFIKNMICGTSQMDVAVLVIAATDGVME-------Q 148

Query: 436 TREHALLAFTLGVKQLIVGVNKMD 507
           T+EH +LA  +GVK + + +NK D
Sbjct: 149 TKEHLILAKQVGVKNMAIFINKAD 172



 Score = 28.7 bits (61), Expect = 5.8
 Identities = 10/20 (50%), Positives = 15/20 (75%)
 Frame = +3

Query: 54  KTHINIVVIGHVDSGKSTTT 113
           K ++N+  IGH+D GK+T T
Sbjct: 43  KINVNVGTIGHIDHGKTTLT 62


>AB010028-1|BAA31345.1|  439|Caenorhabditis elegans mitochondrial
           elongation factorTu homologue protein.
          Length = 439

 Score = 69.3 bits (162), Expect = 3e-12
 Identities = 38/84 (45%), Positives = 51/84 (60%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           I++A   +E+     +  D PGH DFIKNMI GTSQ D AVL++AA  G  E       Q
Sbjct: 96  INVAHIGYESPLRRYSHTDCPGHSDFIKNMICGTSQMDVAVLVIAATDGVME-------Q 148

Query: 436 TREHALLAFTLGVKQLIVGVNKMD 507
           T+EH +LA  +GVK + + +NK D
Sbjct: 149 TKEHLILAKQVGVKNMAIFINKAD 172



 Score = 28.7 bits (61), Expect = 5.8
 Identities = 10/20 (50%), Positives = 15/20 (75%)
 Frame = +3

Query: 54  KTHINIVVIGHVDSGKSTTT 113
           K ++N+  IGH+D GK+T T
Sbjct: 43  KINVNVGTIGHIDHGKTTLT 62


>D38472-1|BAA07492.1|  495|Caenorhabditis elegans elongation factor
           Tu homologueprecursor protein.
          Length = 495

 Score = 66.9 bits (156), Expect = 2e-11
 Identities = 37/82 (45%), Positives = 52/82 (63%), Gaps = 2/82 (2%)
 Frame = +1

Query: 274 KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 453
           ++ET+K +   ID PGH D+IKNMITG +Q + A+L+VAA  G          QTREH L
Sbjct: 106 EYETAKRHYAHIDCPGHADYIKNMITGAAQMEGAILVVAATDGPMP-------QTREHLL 158

Query: 454 LAFTLGV--KQLIVGVNKMDSL 513
           LA  +GV    ++V +NK+D +
Sbjct: 159 LARQVGVPLDNIVVFMNKVDEV 180



 Score = 36.3 bits (80), Expect = 0.029
 Identities = 21/68 (30%), Positives = 34/68 (50%), Gaps = 3/68 (4%)
 Frame = +3

Query: 48  KEKTHINIVVIGHVDSGKSTTTG---HLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWV 218
           ++K H+N+  IGHVD GK+T T     ++    G   R  E  +   +E  +G    A+ 
Sbjct: 45  RDKPHLNVGTIGHVDHGKTTLTSAITKILATSKGAKYRKYEDIDNAPEEKARGITINAFH 104

Query: 219 LDKLKAER 242
           L+   A+R
Sbjct: 105 LEYETAKR 112


>D38471-1|BAA07491.1|  496|Caenorhabditis elegans elongation factor
           Tu homologueprecursor protein.
          Length = 496

 Score = 66.9 bits (156), Expect = 2e-11
 Identities = 37/82 (45%), Positives = 52/82 (63%), Gaps = 2/82 (2%)
 Frame = +1

Query: 274 KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 453
           ++ET+K +   ID PGH D+IKNMITG +Q + A+L+VAA  G          QTREH L
Sbjct: 107 EYETAKRHYAHIDCPGHADYIKNMITGAAQMEGAILVVAATDGPMP-------QTREHLL 159

Query: 454 LAFTLGV--KQLIVGVNKMDSL 513
           LA  +GV    ++V +NK+D +
Sbjct: 160 LARQVGVPLDNIVVFMNKVDEV 181



 Score = 36.3 bits (80), Expect = 0.029
 Identities = 21/68 (30%), Positives = 34/68 (50%), Gaps = 3/68 (4%)
 Frame = +3

Query: 48  KEKTHINIVVIGHVDSGKSTTTG---HLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWV 218
           ++K H+N+  IGHVD GK+T T     ++    G   R  E  +   +E  +G    A+ 
Sbjct: 46  RDKPHLNVGTIGHVDHGKTTLTSAITKILATSKGAKYRKYEDIDNAPEEKARGITINAFH 105

Query: 219 LDKLKAER 242
           L+   A+R
Sbjct: 106 LEYETAKR 113


>AC024859-25|AAK29979.1|  496|Caenorhabditis elegans Tu elongation
           factor (ef-tu), mitochondrialprotein 1 protein.
          Length = 496

 Score = 66.9 bits (156), Expect = 2e-11
 Identities = 37/82 (45%), Positives = 52/82 (63%), Gaps = 2/82 (2%)
 Frame = +1

Query: 274 KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 453
           ++ET+K +   ID PGH D+IKNMITG +Q + A+L+VAA  G          QTREH L
Sbjct: 107 EYETAKRHYAHIDCPGHADYIKNMITGAAQMEGAILVVAATDGPMP-------QTREHLL 159

Query: 454 LAFTLGV--KQLIVGVNKMDSL 513
           LA  +GV    ++V +NK+D +
Sbjct: 160 LARQVGVPLDNIVVFMNKVDEV 181



 Score = 36.3 bits (80), Expect = 0.029
 Identities = 21/68 (30%), Positives = 34/68 (50%), Gaps = 3/68 (4%)
 Frame = +3

Query: 48  KEKTHINIVVIGHVDSGKSTTTG---HLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWV 218
           ++K H+N+  IGHVD GK+T T     ++    G   R  E  +   +E  +G    A+ 
Sbjct: 46  RDKPHLNVGTIGHVDHGKTTLTSAITKILATSKGAKYRKYEDIDNAPEEKARGITINAFH 105

Query: 219 LDKLKAER 242
           L+   A+R
Sbjct: 106 LEYETAKR 113


>Z99709-7|CAB16862.2|  500|Caenorhabditis elegans Hypothetical
           protein C47B2.7b protein.
          Length = 500

 Score = 42.7 bits (96), Expect = 3e-04
 Identities = 26/86 (30%), Positives = 44/86 (51%)
 Frame = +1

Query: 298 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVK 477
           + +ID PGH   I+ ++  ++  D A++I+     +  AGI    QT EH LLA      
Sbjct: 74  LALIDCPGHSGLIRAVLAASTVFDMAIVII-----DVVAGIQP--QTAEHLLLASKFCPN 126

Query: 478 QLIVGVNKMDSLNHHTVSPDLRKSRR 555
           ++I+ +NK D      +S   +K R+
Sbjct: 127 RVIIVLNKCDLAEKSKISESAKKVRK 152



 Score = 28.7 bits (61), Expect = 5.8
 Identities = 10/17 (58%), Positives = 15/17 (88%)
 Frame = +3

Query: 63  INIVVIGHVDSGKSTTT 113
           +N+ ++GHVDSGK+T T
Sbjct: 14  LNLGILGHVDSGKTTLT 30


>Z70780-15|CAA94822.2|  702|Caenorhabditis elegans Hypothetical
           protein F46B6.6a protein.
          Length = 702

 Score = 41.1 bits (92), Expect = 0.001
 Identities = 29/73 (39%), Positives = 34/73 (46%)
 Frame = +1

Query: 298 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVK 477
           VT +D PGH  F      G   AD  VL+VAA  G  E       QT +    A    V 
Sbjct: 206 VTFLDTPGHAAFASMRARGAKGADIVVLVVAADDGVKE-------QTAQSIKFAKDANV- 257

Query: 478 QLIVGVNKMDSLN 516
           QL+V VNK+D  N
Sbjct: 258 QLVVAVNKIDKPN 270


>L13200-4|AAA28191.2|  645|Caenorhabditis elegans Hypothetical
           protein ZK1236.1 protein.
          Length = 645

 Score = 34.7 bits (76), Expect = 0.088
 Identities = 24/72 (33%), Positives = 35/72 (48%)
 Frame = +1

Query: 292 YYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLG 471
           Y + +ID PGH DF   +    +  D  +L+VAA  G          QT  +  LAF   
Sbjct: 102 YLLNLIDTPGHVDFSAEVSRSLAVCDGILLLVAANQG-------VQAQTIANFWLAFEKN 154

Query: 472 VKQLIVGVNKMD 507
           + Q+I  +NK+D
Sbjct: 155 I-QIIPVINKID 165



 Score = 32.3 bits (70), Expect = 0.47
 Identities = 14/42 (33%), Positives = 23/42 (54%), Gaps = 3/42 (7%)
 Frame = +3

Query: 66  NIVVIGHVDSGKSTTTGHLIYKCGGI---DKRTIEKFEKEAQ 182
           N  ++ HVD GKST    L+  CG +    K+ ++K + E +
Sbjct: 44  NFGIVAHVDHGKSTLADRLLEMCGAVPPGQKQMLDKLQVERE 85


>AC006714-2|AAK29716.2|  689|Caenorhabditis elegans Hypothetical
           protein Y119D3B.14 protein.
          Length = 689

 Score = 34.3 bits (75), Expect = 0.12
 Identities = 15/26 (57%), Positives = 18/26 (69%)
 Frame = +3

Query: 66  NIVVIGHVDSGKSTTTGHLIYKCGGI 143
           NI VI HVD+GK+T T  L+Y  G I
Sbjct: 27  NIGVIAHVDAGKTTVTERLLYLAGAI 52


>DQ867020-1|ABI49097.1| 1074|Caenorhabditis elegans eukaryotic
           translation initiationfactor eIF5B protein.
          Length = 1074

 Score = 33.9 bits (74), Expect = 0.15
 Identities = 30/107 (28%), Positives = 47/107 (43%), Gaps = 5/107 (4%)
 Frame = +1

Query: 304 IIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQL 483
           IID PGH  F      G+S  D A+L+V     +   G+    QT E +L     G    
Sbjct: 553 IIDTPGHESFSNLRTRGSSLCDFAILVV-----DIMHGLEP--QTIE-SLKLLIKGKTPF 604

Query: 484 IVGVNKMDSLNHHTVSP-----DLRKSRRKYPHTSRRLGYNPAAVAF 609
           ++ +NK+D L  +  +P     +L KS++       +  +N   V F
Sbjct: 605 VIALNKIDRLYEYESNPRKDVYELLKSQKPRVQAEFKERFNQIVVEF 651


>AC025716-9|AAK39619.1|  469|Caenorhabditis elegans Hypothetical
           protein Y39G10AR.8 protein.
          Length = 469

 Score = 33.9 bits (74), Expect = 0.15
 Identities = 20/71 (28%), Positives = 32/71 (45%)
 Frame = +1

Query: 295 YVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGV 474
           +V+ +D PGH   +  M+ G +  D A L+VA              QT EH      + +
Sbjct: 128 HVSFVDCPGHDILMATMLNGAAVMDAAFLLVAGNEP------CPQPQTSEHLAAVEIMQL 181

Query: 475 KQLIVGVNKMD 507
             L++  NK+D
Sbjct: 182 NHLMILQNKVD 192


>AC024817-55|AAF59563.3|  366|Caenorhabditis elegans Hypothetical
           protein Y54G2A.28 protein.
          Length = 366

 Score = 33.5 bits (73), Expect = 0.20
 Identities = 18/43 (41%), Positives = 24/43 (55%)
 Frame = -1

Query: 500 LFTPTMSCLTPRVKASKACSRV*PFLEIPASNSPVPAATMSTA 372
           LF PT+SC+  +  AS   S   P +  PA N  VP AT+S +
Sbjct: 13  LFDPTLSCMATQNSASATLSCANPTVAAPA-NDDVPEATLSVS 54


>Z81519-1|CAB04216.1|  750|Caenorhabditis elegans Hypothetical
           protein F29C12.4 protein.
          Length = 750

 Score = 33.1 bits (72), Expect = 0.27
 Identities = 13/27 (48%), Positives = 18/27 (66%)
 Frame = +3

Query: 66  NIVVIGHVDSGKSTTTGHLIYKCGGID 146
           NI +  H+DSGK+T T  ++Y  G ID
Sbjct: 46  NIGISAHIDSGKTTVTERILYYAGRID 72



 Score = 29.1 bits (62), Expect = 4.4
 Identities = 29/92 (31%), Positives = 37/92 (40%)
 Frame = +1

Query: 298 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVK 477
           + IID PGH DF   +       D AVL++  G G    G+     T    L  + +   
Sbjct: 114 INIIDTPGHVDFTVEVERALRVLDGAVLVL-CGVG----GVQSQTFTVNRQLARYNV--- 165

Query: 478 QLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTS 573
             I  VNKMD  N  T    L   R K  H +
Sbjct: 166 PFICFVNKMDR-NGATPLKALDGLRNKLNHNA 196


>Z81068-5|CAB02985.1|  852|Caenorhabditis elegans Hypothetical
           protein F25H5.4 protein.
          Length = 852

 Score = 32.7 bits (71), Expect = 0.36
 Identities = 15/32 (46%), Positives = 20/32 (62%)
 Frame = +3

Query: 42  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCG 137
           M +++   N+ VI HVD GKST T  L+ K G
Sbjct: 13  MDRKRNIRNMSVIAHVDHGKSTLTDSLVSKAG 44



 Score = 28.3 bits (60), Expect = 7.7
 Identities = 11/37 (29%), Positives = 20/37 (54%)
 Frame = +1

Query: 292 YYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 402
           + + +ID+PGH DF   +       D A+++V   +G
Sbjct: 110 FLINLIDSPGHVDFSSEVTAALRVTDGALVVVDCVSG 146


>M86959-1|AAD03339.1|  852|Caenorhabditis elegans elongation factor
           protein.
          Length = 852

 Score = 32.7 bits (71), Expect = 0.36
 Identities = 15/32 (46%), Positives = 20/32 (62%)
 Frame = +3

Query: 42  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCG 137
           M +++   N+ VI HVD GKST T  L+ K G
Sbjct: 13  MDRKRNIRNMSVIAHVDHGKSTLTDSLVSKAG 44



 Score = 28.7 bits (61), Expect = 5.8
 Identities = 11/37 (29%), Positives = 20/37 (54%)
 Frame = +1

Query: 292 YYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 402
           + + +ID+PGH DF   +       D A+++V   +G
Sbjct: 110 FLINLIDSPGHVDFSSEVTAALGVTDGALVVVDCVSG 146


>U50193-2|AAA91248.1|  974|Caenorhabditis elegans Elongation factor
           protein 1 protein.
          Length = 974

 Score = 31.9 bits (69), Expect = 0.62
 Identities = 17/55 (30%), Positives = 24/55 (43%)
 Frame = +1

Query: 238 SVXRYQIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 402
           S+    + I      +  Y + IID PGH +F   M      AD  V++V A  G
Sbjct: 183 SIKSQPVSIVAQDSRSKSYLLNIIDTPGHVNFSDEMTASYRLADGVVVMVDAHEG 237


>M86958-1|AAA21824.1|  849|Caenorhabditis elegans eft-1 protein.
          Length = 849

 Score = 31.9 bits (69), Expect = 0.62
 Identities = 17/55 (30%), Positives = 24/55 (43%)
 Frame = +1

Query: 238 SVXRYQIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 402
           S+    + I      +  Y + IID PGH +F   M      AD  V++V A  G
Sbjct: 58  SIKSQPVSIVAQDSRSKSYLLNIIDTPGHVNFSDEMTASYRLADGVVVMVDAHEG 112


>L40996-1|AAA86431.1|  593|Caenorhabditis elegans GTP-binding
           protein protein.
          Length = 593

 Score = 31.1 bits (67), Expect = 1.1
 Identities = 15/37 (40%), Positives = 23/37 (62%)
 Frame = +3

Query: 18  FVIRD*PKMGKEKTHINIVVIGHVDSGKSTTTGHLIY 128
           ++IRD P   K+     + V+G+VD+GKST  G L +
Sbjct: 127 WIIRD-PPTEKDFIEARVAVVGNVDAGKSTLLGVLTH 162


>AF125969-2|AAD14761.1|  613|Caenorhabditis elegans Caenorhabditis
           gtp-binding proteinprotein 1 protein.
          Length = 613

 Score = 31.1 bits (67), Expect = 1.1
 Identities = 15/37 (40%), Positives = 23/37 (62%)
 Frame = +3

Query: 18  FVIRD*PKMGKEKTHINIVVIGHVDSGKSTTTGHLIY 128
           ++IRD P   K+     + V+G+VD+GKST  G L +
Sbjct: 127 WIIRD-PPTEKDFIEARVAVVGNVDAGKSTLLGVLTH 162


>AL032643-4|CAA21662.1|  436|Caenorhabditis elegans Hypothetical
           protein Y54E5A.6 protein.
          Length = 436

 Score = 30.3 bits (65), Expect = 1.9
 Identities = 12/30 (40%), Positives = 19/30 (63%)
 Frame = +1

Query: 781 FPARRIXNSVVXVPCPSGRI*NWCVENQVP 870
           FP +R+ NSV   P P   + ++CVE ++P
Sbjct: 345 FPLKRLKNSVGFSPTPKMVLHDYCVETKIP 374


>Z66513-12|CAI46602.1|  492|Caenorhabditis elegans Hypothetical
           protein F54D5.5b protein.
          Length = 492

 Score = 29.5 bits (63), Expect = 3.3
 Identities = 13/34 (38%), Positives = 19/34 (55%)
 Frame = +3

Query: 144 DKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERE 245
           +KR ++  EKE  +     F Y   LDK+K ER+
Sbjct: 272 EKRKLKDMEKECNDAKNAMFHYMNQLDKVKKERD 305


>Z66513-11|CAA91332.3|  427|Caenorhabditis elegans Hypothetical
           protein F54D5.5a protein.
          Length = 427

 Score = 29.5 bits (63), Expect = 3.3
 Identities = 13/34 (38%), Positives = 19/34 (55%)
 Frame = +3

Query: 144 DKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERE 245
           +KR ++  EKE  +     F Y   LDK+K ER+
Sbjct: 207 EKRKLKDMEKECNDAKNAMFHYMNQLDKVKKERD 240


>AC084152-1|AAM69074.2|  332|Caenorhabditis elegans Hypothetical
           protein Y102A11A.9 protein.
          Length = 332

 Score = 29.1 bits (62), Expect = 4.4
 Identities = 17/48 (35%), Positives = 25/48 (52%)
 Frame = +3

Query: 141 IDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAEREXVSNRYCSLEVRN 284
           +DK  ++   KE  E+ K   KYA    KLK + + V N Y S+  +N
Sbjct: 188 LDKSRVKTASKERNELAK---KYAEQNAKLKLKLKEVKNNYASMLEKN 232


>Z99709-6|CAB16863.1|  459|Caenorhabditis elegans Hypothetical
           protein C47B2.7a protein.
          Length = 459

 Score = 28.7 bits (61), Expect = 5.8
 Identities = 10/17 (58%), Positives = 15/17 (88%)
 Frame = +3

Query: 63  INIVVIGHVDSGKSTTT 113
           +N+ ++GHVDSGK+T T
Sbjct: 14  LNLGILGHVDSGKTTLT 30


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 20,541,035
Number of Sequences: 27780
Number of extensions: 442191
Number of successful extensions: 1346
Number of sequences better than 10.0: 32
Number of HSP's better than 10.0 without gapping: 1236
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1325
length of database: 12,740,198
effective HSP length: 81
effective length of database: 10,490,018
effective search space used: 2213393798
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -