SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30141.Seq
         (897 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U29378-3|AAA68723.2|  330|Caenorhabditis elegans Stomatin protei...    29   3.4  
U29378-2|ABS19471.1|  325|Caenorhabditis elegans Stomatin protei...    29   3.4  
U20555-1|AAC46918.1|  839|Caenorhabditis elegans zinc finger pro...    29   3.4  
L23645-6|AAO91714.1|  635|Caenorhabditis elegans Zinc finger pro...    29   3.4  
L23645-4|AAK26137.1|  867|Caenorhabditis elegans Zinc finger pro...    29   3.4  
U70852-1|AAK29815.1| 2361|Caenorhabditis elegans Hypothetical pr...    24   3.6  
AF040655-12|AAB95039.1|  507|Caenorhabditis elegans Hypothetical...    29   4.5  
Z81467-3|CAC42255.1| 1143|Caenorhabditis elegans Hypothetical pr...    29   6.0  
Z81467-2|CAC42254.1| 1147|Caenorhabditis elegans Hypothetical pr...    29   6.0  
AL032655-7|CAH60798.1|  329|Caenorhabditis elegans Hypothetical ...    29   6.0  
AF195611-1|AAF15530.1| 1147|Caenorhabditis elegans LIN-41B protein.    29   6.0  
AF195610-1|AAF15529.1| 1143|Caenorhabditis elegans LIN-41A protein.    29   6.0  
Z83233-9|CAB05766.1|  405|Caenorhabditis elegans Hypothetical pr...    28   7.9  

>U29378-3|AAA68723.2|  330|Caenorhabditis elegans Stomatin protein
           1, isoform a protein.
          Length = 330

 Score = 29.5 bits (63), Expect = 3.4
 Identities = 21/69 (30%), Positives = 31/69 (44%)
 Frame = +3

Query: 444 LRAILGTLTVEEVYKDRDQFAGWYAKWLRRTSEEWESRFCPSRLRTSTTMSSIWASLGKF 623
           LR ILGT T+ E+  DR++ +      L   +E W  +     LR     S +  ++   
Sbjct: 160 LRTILGTHTLSEILSDREKISADMKISLDEATEPWGIKVERVELRDVRLPSQMQRAMA-- 217

Query: 624 ATANVKRDA 650
           A A   RDA
Sbjct: 218 AEAEATRDA 226


>U29378-2|ABS19471.1|  325|Caenorhabditis elegans Stomatin protein
           1, isoform b protein.
          Length = 325

 Score = 29.5 bits (63), Expect = 3.4
 Identities = 21/69 (30%), Positives = 31/69 (44%)
 Frame = +3

Query: 444 LRAILGTLTVEEVYKDRDQFAGWYAKWLRRTSEEWESRFCPSRLRTSTTMSSIWASLGKF 623
           LR ILGT T+ E+  DR++ +      L   +E W  +     LR     S +  ++   
Sbjct: 160 LRTILGTHTLSEILSDREKISADMKISLDEATEPWGIKVERVELRDVRLPSQMQRAMA-- 217

Query: 624 ATANVKRDA 650
           A A   RDA
Sbjct: 218 AEAEATRDA 226


>U20555-1|AAC46918.1|  839|Caenorhabditis elegans zinc finger
           protein protein.
          Length = 839

 Score = 29.5 bits (63), Expect = 3.4
 Identities = 25/74 (33%), Positives = 35/74 (47%), Gaps = 1/74 (1%)
 Frame = -3

Query: 508 PANWSLSLYTSSTVRVPRIARK*PSNVCRTVIL-ISLTVLPRNCSQAVVRSSSSFMILHW 332
           PAN S SL+          +RK PSN+  TV L  + T L    + +     +S +  H 
Sbjct: 707 PANHSSSLFEDIKAPKATYSRKTPSNIPLTVPLSTAATALTTTTAASSGAPVNSNIQNHR 766

Query: 331 ATPVTVSGTPWAVS 290
           ATP T +G P A +
Sbjct: 767 ATPST-AGAPMAAT 779


>L23645-6|AAO91714.1|  635|Caenorhabditis elegans Zinc finger
           protein protein 1,isoform c protein.
          Length = 635

 Score = 29.5 bits (63), Expect = 3.4
 Identities = 25/74 (33%), Positives = 35/74 (47%), Gaps = 1/74 (1%)
 Frame = -3

Query: 508 PANWSLSLYTSSTVRVPRIARK*PSNVCRTVIL-ISLTVLPRNCSQAVVRSSSSFMILHW 332
           PAN S SL+          +RK PSN+  TV L  + T L    + +     +S +  H 
Sbjct: 475 PANHSSSLFEDIKAPKATYSRKTPSNIPLTVPLSTAATALTTTTAASSGAPVNSNIQNHR 534

Query: 331 ATPVTVSGTPWAVS 290
           ATP T +G P A +
Sbjct: 535 ATPST-AGAPMAAT 547


>L23645-4|AAK26137.1|  867|Caenorhabditis elegans Zinc finger
           protein protein 1,isoform a protein.
          Length = 867

 Score = 29.5 bits (63), Expect = 3.4
 Identities = 25/74 (33%), Positives = 35/74 (47%), Gaps = 1/74 (1%)
 Frame = -3

Query: 508 PANWSLSLYTSSTVRVPRIARK*PSNVCRTVIL-ISLTVLPRNCSQAVVRSSSSFMILHW 332
           PAN S SL+          +RK PSN+  TV L  + T L    + +     +S +  H 
Sbjct: 707 PANHSSSLFEDIKAPKATYSRKTPSNIPLTVPLSTAATALTTTTAASSGAPVNSNIQNHR 766

Query: 331 ATPVTVSGTPWAVS 290
           ATP T +G P A +
Sbjct: 767 ATPST-AGAPMAAT 779


>U70852-1|AAK29815.1| 2361|Caenorhabditis elegans Hypothetical protein
            F45E4.4 protein.
          Length = 2361

 Score = 24.2 bits (50), Expect(2) = 3.6
 Identities = 18/73 (24%), Positives = 32/73 (43%)
 Frame = +2

Query: 422  PANVGGSFASYSRNSYSRRGVQRQGPIRGLVREVAAPDVGRMGIEILSFTIKDVYDDVQY 601
            P     S AS   + Y  R +         +R+ +  D+G+   E LSF  + ++D+ + 
Sbjct: 943  PTPSADSMASRKSSEYDIRSISE-------IRQESESDIGKWYEEQLSFMRQSIHDEEED 995

Query: 602  LGQLGEVRNGQRE 640
            +G   E+R    E
Sbjct: 996  VGH--EIRTDVEE 1006



 Score = 23.4 bits (48), Expect(2) = 3.6
 Identities = 12/40 (30%), Positives = 18/40 (45%)
 Frame = +2

Query: 326 SRPVQDHERRRTSHNCLRAVPGQDRQRD*DDCPANVGGSF 445
           + PVQD E    + +   A  G D   + +D  +   GSF
Sbjct: 863 AEPVQDEEEEPITESGSDATSGADIFDEQEDASSGASGSF 902


>AF040655-12|AAB95039.1|  507|Caenorhabditis elegans Hypothetical
           protein T24E12.1 protein.
          Length = 507

 Score = 29.1 bits (62), Expect = 4.5
 Identities = 23/73 (31%), Positives = 32/73 (43%)
 Frame = +3

Query: 435 EGHLRAILGTLTVEEVYKDRDQFAGWYAKWLRRTSEEWESRFCPSRLRTSTTMSSIWASL 614
           E  LR  L    +  V + + + A  Y+ +  +   E E R+ P  LR S     IWA +
Sbjct: 160 ETDLRCCLFDPEIPHVPQFKKRPANGYSLYQNQRKSE-EGRYEPW-LRLSKKKKEIWAEM 217

Query: 615 GKFATANVKRDAE 653
           GK   A   R AE
Sbjct: 218 GKKVRAEQNRQAE 230


>Z81467-3|CAC42255.1| 1143|Caenorhabditis elegans Hypothetical
           protein C12C8.3b protein.
          Length = 1143

 Score = 28.7 bits (61), Expect = 6.0
 Identities = 20/55 (36%), Positives = 29/55 (52%), Gaps = 3/55 (5%)
 Frame = +3

Query: 309 PLTVTGVAQCKIMNEDELLTTACEQFLGKTVKEI---KMTVLQTLEGHLRAILGT 464
           PL    VA  +++NE +LL   CE+  G T+K+I    +T   T E  +RA   T
Sbjct: 511 PLGDIRVAVGEVVNESQLLQWQCEK-TGDTIKQIIDGIVTNATTAENEIRAAFDT 564


>Z81467-2|CAC42254.1| 1147|Caenorhabditis elegans Hypothetical
           protein C12C8.3a protein.
          Length = 1147

 Score = 28.7 bits (61), Expect = 6.0
 Identities = 20/55 (36%), Positives = 29/55 (52%), Gaps = 3/55 (5%)
 Frame = +3

Query: 309 PLTVTGVAQCKIMNEDELLTTACEQFLGKTVKEI---KMTVLQTLEGHLRAILGT 464
           PL    VA  +++NE +LL   CE+  G T+K+I    +T   T E  +RA   T
Sbjct: 515 PLGDIRVAVGEVVNESQLLQWQCEK-TGDTIKQIIDGIVTNATTAENEIRAAFDT 568


>AL032655-7|CAH60798.1|  329|Caenorhabditis elegans Hypothetical
           protein Y6B3B.12 protein.
          Length = 329

 Score = 28.7 bits (61), Expect = 6.0
 Identities = 25/99 (25%), Positives = 45/99 (45%)
 Frame = +3

Query: 357 ELLTTACEQFLGKTVKEIKMTVLQTLEGHLRAILGTLTVEEVYKDRDQFAGWYAKWLRRT 536
           +L+   C      T  +  M  LQ+     ++++ T+ VE+ + D+D+      + ++R 
Sbjct: 42  DLMYEMCRSEQSVTGCKEAMLYLQSASNDFKSLIETINVEKQW-DQDENR---QEQIKRP 97

Query: 537 SEEWESRFCPSRLRTSTTMSSIWASLGKFATANVKRDAE 653
           S  WE R   S    +  +SSI A   K A+    + AE
Sbjct: 98  SVAWEVRKSMSSPNPALPISSIIAEAVKNASPPTNKAAE 136


>AF195611-1|AAF15530.1| 1147|Caenorhabditis elegans LIN-41B protein.
          Length = 1147

 Score = 28.7 bits (61), Expect = 6.0
 Identities = 20/55 (36%), Positives = 29/55 (52%), Gaps = 3/55 (5%)
 Frame = +3

Query: 309 PLTVTGVAQCKIMNEDELLTTACEQFLGKTVKEI---KMTVLQTLEGHLRAILGT 464
           PL    VA  +++NE +LL   CE+  G T+K+I    +T   T E  +RA   T
Sbjct: 515 PLGDIRVAVGEVVNESQLLQWQCEK-TGDTIKQIIDGIVTNATTAENEIRAAFDT 568


>AF195610-1|AAF15529.1| 1143|Caenorhabditis elegans LIN-41A protein.
          Length = 1143

 Score = 28.7 bits (61), Expect = 6.0
 Identities = 20/55 (36%), Positives = 29/55 (52%), Gaps = 3/55 (5%)
 Frame = +3

Query: 309 PLTVTGVAQCKIMNEDELLTTACEQFLGKTVKEI---KMTVLQTLEGHLRAILGT 464
           PL    VA  +++NE +LL   CE+  G T+K+I    +T   T E  +RA   T
Sbjct: 511 PLGDIRVAVGEVVNESQLLQWQCEK-TGDTIKQIIDGIVTNATTAENEIRAAFDT 564


>Z83233-9|CAB05766.1|  405|Caenorhabditis elegans Hypothetical
           protein K06B4.10 protein.
          Length = 405

 Score = 28.3 bits (60), Expect = 7.9
 Identities = 11/24 (45%), Positives = 16/24 (66%)
 Frame = -1

Query: 135 DSVDVAHFESFYSDFHDTHTALHN 64
           D +D+AH ESF+++ H T T   N
Sbjct: 230 DYIDLAHSESFFTNDHQTFTERDN 253


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 22,020,121
Number of Sequences: 27780
Number of extensions: 507068
Number of successful extensions: 1464
Number of sequences better than 10.0: 13
Number of HSP's better than 10.0 without gapping: 1386
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1464
length of database: 12,740,198
effective HSP length: 81
effective length of database: 10,490,018
effective search space used: 2276333906
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -