SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30139.Seq
         (697 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z79601-1|CAB01885.2|  716|Caenorhabditis elegans Hypothetical pr...    60   2e-09
AL132902-8|CAC14423.2|  699|Caenorhabditis elegans Hypothetical ...    49   3e-06
AL132898-1|CAC14405.1|  357|Caenorhabditis elegans Hypothetical ...    48   8e-06
Z68338-9|CAA92762.2| 2923|Caenorhabditis elegans Hypothetical pr...    44   1e-04
Z68338-8|CAA92761.2| 2920|Caenorhabditis elegans Hypothetical pr...    44   1e-04
Z54218-6|CAA90960.2| 2923|Caenorhabditis elegans Hypothetical pr...    44   1e-04
Z54218-5|CAA90959.2| 2920|Caenorhabditis elegans Hypothetical pr...    44   1e-04
AF100662-1|AAC68977.1|  900|Caenorhabditis elegans Hypothetical ...    43   2e-04
Z47812-1|CAA87795.2| 1326|Caenorhabditis elegans Hypothetical pr...    42   6e-04
Z29095-12|CAB54287.2|  414|Caenorhabditis elegans Hypothetical p...    41   7e-04
Z29095-11|CAB54286.2|  426|Caenorhabditis elegans Hypothetical p...    41   7e-04
Z81072-15|CAB03026.2| 1262|Caenorhabditis elegans Hypothetical p...    41   0.001
Z81048-10|CAB02845.2| 1262|Caenorhabditis elegans Hypothetical p...    41   0.001
Z66511-5|CAA91317.1| 1095|Caenorhabditis elegans Hypothetical pr...    40   0.002
U50193-6|AAL32262.1| 1175|Caenorhabditis elegans Cytokinesis def...    36   0.037
U50193-5|AAL32263.1| 1178|Caenorhabditis elegans Cytokinesis def...    36   0.037
AF469173-1|AAL79016.1| 1175|Caenorhabditis elegans ubiquitin c-t...    36   0.037
U64844-5|AAM45362.1|  368|Caenorhabditis elegans Hypothetical pr...    34   0.11 
U64844-4|AAB18307.1|  376|Caenorhabditis elegans Hypothetical pr...    34   0.11 
Z92835-4|CAE54910.1| 1135|Caenorhabditis elegans Hypothetical pr...    31   1.0  
Z92835-3|CAB07397.1| 1130|Caenorhabditis elegans Hypothetical pr...    31   1.0  
Z92835-2|CAB07396.1| 1133|Caenorhabditis elegans Hypothetical pr...    31   1.0  
Z81507-2|CAB04135.1|  388|Caenorhabditis elegans Hypothetical pr...    29   4.2  
AF106582-1|AAC78217.3| 1424|Caenorhabditis elegans Hypothetical ...    29   4.2  
Z81482-5|CAB03956.3|  409|Caenorhabditis elegans Hypothetical pr...    28   5.5  
U72211-1|AAB97099.1|  409|Caenorhabditis elegans putative transc...    28   5.5  
Z69385-4|CAA93427.2| 1326|Caenorhabditis elegans Hypothetical pr...    28   7.3  

>Z79601-1|CAB01885.2|  716|Caenorhabditis elegans Hypothetical
           protein K09A9.4 protein.
          Length = 716

 Score = 59.7 bits (138), Expect = 2e-09
 Identities = 28/62 (45%), Positives = 37/62 (59%)
 Frame = +3

Query: 312 SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFSA 491
           SL+ CL  FF    L+ DN YSCS+C+ L +  K +    LP V+ + LKRFRH +  S 
Sbjct: 403 SLESCLDRFFQNSTLQDDNQYSCSKCEVLVDATKSTKAHRLPEVIIIQLKRFRHTMFGSC 462

Query: 492 KV 497
           KV
Sbjct: 463 KV 464



 Score = 35.1 bits (77), Expect = 0.048
 Identities = 17/38 (44%), Positives = 23/38 (60%)
 Frame = +1

Query: 64  RSIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPI 177
           ++ IS +F G L + +QC  C   S  IE F DLS+PI
Sbjct: 320 KTAISAIFQGVLENQIQCHSCGFRSRTIENFLDLSIPI 357


>AL132902-8|CAC14423.2|  699|Caenorhabditis elegans Hypothetical
           protein Y71A12B.9 protein.
          Length = 699

 Score = 49.2 bits (112), Expect = 3e-06
 Identities = 23/54 (42%), Positives = 31/54 (57%)
 Frame = +3

Query: 309 VSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFR 470
           V L DCL+ FF  + L+      C++CK  +   K   I  LP VLC+H+KRFR
Sbjct: 550 VRLSDCLSTFFKLEMLEKGEKPECAKCKTKQTCSKQMFIRKLPQVLCLHMKRFR 603



 Score = 39.5 bits (88), Expect = 0.002
 Identities = 19/45 (42%), Positives = 27/45 (60%)
 Frame = +1

Query: 73  ISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSREHLAVLR 207
           IS  F G L S+V C  C   S +I+ F DLSL IP++ + + +R
Sbjct: 507 ISKYFEGTLQSSVICQTCRNCSNKIDEFMDLSLDIPAQRNASKVR 551


>AL132898-1|CAC14405.1|  357|Caenorhabditis elegans Hypothetical
           protein Y59A8B.2 protein.
          Length = 357

 Score = 47.6 bits (108), Expect = 8e-06
 Identities = 21/52 (40%), Positives = 32/52 (61%)
 Frame = +3

Query: 312 SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRF 467
           SL  CL + FS  +L GD+ ++C +CK+ R   + S +   P V+ +HLKRF
Sbjct: 210 SLDMCLRSHFSQTKLDGDSRWNCPKCKEPRASTRTSKLWQPPPVMIIHLKRF 261


>Z68338-9|CAA92762.2| 2923|Caenorhabditis elegans Hypothetical protein
            T24B8.7b protein.
          Length = 2923

 Score = 44.0 bits (99), Expect = 1e-04
 Identities = 16/57 (28%), Positives = 34/57 (59%)
 Frame = +3

Query: 312  SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELL 482
            +L++ L  F +A  ++G+N Y C +C + +  +  +  + LP  + + LKRF ++L+
Sbjct: 1921 NLEEALENFLAAHVMEGENAYHCEKCDEKKTTLNRTSFLELPSTMTIQLKRFTYDLV 1977


>Z68338-8|CAA92761.2| 2920|Caenorhabditis elegans Hypothetical protein
            T24B8.7a protein.
          Length = 2920

 Score = 44.0 bits (99), Expect = 1e-04
 Identities = 16/57 (28%), Positives = 34/57 (59%)
 Frame = +3

Query: 312  SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELL 482
            +L++ L  F +A  ++G+N Y C +C + +  +  +  + LP  + + LKRF ++L+
Sbjct: 1918 NLEEALENFLAAHVMEGENAYHCEKCDEKKTTLNRTSFLELPSTMTIQLKRFTYDLV 1974


>Z54218-6|CAA90960.2| 2923|Caenorhabditis elegans Hypothetical protein
            T24B8.7b protein.
          Length = 2923

 Score = 44.0 bits (99), Expect = 1e-04
 Identities = 16/57 (28%), Positives = 34/57 (59%)
 Frame = +3

Query: 312  SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELL 482
            +L++ L  F +A  ++G+N Y C +C + +  +  +  + LP  + + LKRF ++L+
Sbjct: 1921 NLEEALENFLAAHVMEGENAYHCEKCDEKKTTLNRTSFLELPSTMTIQLKRFTYDLV 1977


>Z54218-5|CAA90959.2| 2920|Caenorhabditis elegans Hypothetical protein
            T24B8.7a protein.
          Length = 2920

 Score = 44.0 bits (99), Expect = 1e-04
 Identities = 16/57 (28%), Positives = 34/57 (59%)
 Frame = +3

Query: 312  SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELL 482
            +L++ L  F +A  ++G+N Y C +C + +  +  +  + LP  + + LKRF ++L+
Sbjct: 1918 NLEEALENFLAAHVMEGENAYHCEKCDEKKTTLNRTSFLELPSTMTIQLKRFTYDLV 1974


>AF100662-1|AAC68977.1|  900|Caenorhabditis elegans Hypothetical
            protein H34C03.2 protein.
          Length = 900

 Score = 42.7 bits (96), Expect = 2e-04
 Identities = 31/107 (28%), Positives = 48/107 (44%), Gaps = 1/107 (0%)
 Frame = +3

Query: 309  VSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFS 488
            V LQ+ L  F + ++L   + + C +CKK     K   +  LP +L +HLKRF++     
Sbjct: 698  VLLQETLDWFTTKEQLGEQDSWYCPQCKKHERATKQLALWKLPEILILHLKRFQYTKWSR 757

Query: 489  AKVXXXXXXXXTIWT*RLTRTKSAPRXVSR-YSLXAVISHMGTVGGG 626
             K+         +    LT   + P      Y L AV  H G++ GG
Sbjct: 758  EKL--TWEVVIPVRGLDLTDKVANPNHEKAIYDLIAVSRHYGSLSGG 802



 Score = 41.9 bits (94), Expect = 4e-04
 Identities = 17/43 (39%), Positives = 28/43 (65%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSREHL 195
           SII D   G+L S + C +C+++S + + F  LSLP+P +E +
Sbjct: 419 SIIVDTLHGQLKSTLICPVCEKISIKFDPFGYLSLPLPPKEQI 461


>Z47812-1|CAA87795.2| 1326|Caenorhabditis elegans Hypothetical
           protein T05H10.1 protein.
          Length = 1326

 Score = 41.5 bits (93), Expect = 6e-04
 Identities = 19/52 (36%), Positives = 27/52 (51%)
 Frame = +3

Query: 312 SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRF 467
           S+++ L AF   + L G N Y C  CK  ++  K   I   P +L + LKRF
Sbjct: 249 SVEEALTAFVQPELLDGSNQYMCENCKSKQDAHKGLRITQFPYLLTIQLKRF 300



 Score = 31.5 bits (68), Expect = 0.60
 Identities = 13/40 (32%), Positives = 22/40 (55%)
 Frame = +1

Query: 58  KYRSIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPI 177
           ++  +I D++ G +   V CL C R S + + F DL L +
Sbjct: 199 EHEKLIQDLYRGTMEDFVACLKCGRESVKTDYFLDLPLAV 238


>Z29095-12|CAB54287.2|  414|Caenorhabditis elegans Hypothetical
           protein R10E11.3b protein.
          Length = 414

 Score = 41.1 bits (92), Expect = 7e-04
 Identities = 19/53 (35%), Positives = 25/53 (47%)
 Frame = +3

Query: 312 SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFR 470
           S+  CL  F   + L GD  Y C  C   +   K   I   P +L +HLKRF+
Sbjct: 224 SISHCLRVFSETETLCGDQKYFCETCSSKQEAQKRMRIKKPPQLLALHLKRFK 276



 Score = 34.3 bits (75), Expect = 0.084
 Identities = 14/35 (40%), Positives = 23/35 (65%)
 Frame = +1

Query: 73  ISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPI 177
           I ++F G L +  +CL C+ VS++ E F DLS+ +
Sbjct: 185 IHEIFQGILTNETRCLSCETVSSKDEDFLDLSIDV 219


>Z29095-11|CAB54286.2|  426|Caenorhabditis elegans Hypothetical
           protein R10E11.3a protein.
          Length = 426

 Score = 41.1 bits (92), Expect = 7e-04
 Identities = 19/53 (35%), Positives = 25/53 (47%)
 Frame = +3

Query: 312 SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFR 470
           S+  CL  F   + L GD  Y C  C   +   K   I   P +L +HLKRF+
Sbjct: 236 SISHCLRVFSETETLCGDQKYFCETCSSKQEAQKRMRIKKPPQLLALHLKRFK 288



 Score = 34.3 bits (75), Expect = 0.084
 Identities = 14/35 (40%), Positives = 23/35 (65%)
 Frame = +1

Query: 73  ISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPI 177
           I ++F G L +  +CL C+ VS++ E F DLS+ +
Sbjct: 197 IHEIFQGILTNETRCLSCETVSSKDEDFLDLSIDV 231


>Z81072-15|CAB03026.2| 1262|Caenorhabditis elegans Hypothetical
           protein F30A10.10 protein.
          Length = 1262

 Score = 40.7 bits (91), Expect = 0.001
 Identities = 30/101 (29%), Positives = 42/101 (41%), Gaps = 1/101 (0%)
 Frame = +3

Query: 312 SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFSA 491
           +L D L A+F  + L     + CS+C K  +  K S  V LP V+ + L R+++      
Sbjct: 262 TLLDALDAYFGEEHLDD---FKCSKCNKTGDVSKQSDYVKLPPVIVIQLNRYKYTSKGRQ 318

Query: 492 KVXXXXXXXXTIWT*RLTRT-KSAPRXVSRYSLXAVISHMG 611
           K+         I      RT  S P     Y L AV  H G
Sbjct: 319 KLKTPMAYPREIPAKAFQRTNNSIPPPAEMYDLFAVTIHEG 359


>Z81048-10|CAB02845.2| 1262|Caenorhabditis elegans Hypothetical
           protein F30A10.10 protein.
          Length = 1262

 Score = 40.7 bits (91), Expect = 0.001
 Identities = 30/101 (29%), Positives = 42/101 (41%), Gaps = 1/101 (0%)
 Frame = +3

Query: 312 SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFSA 491
           +L D L A+F  + L     + CS+C K  +  K S  V LP V+ + L R+++      
Sbjct: 262 TLLDALDAYFGEEHLDD---FKCSKCNKTGDVSKQSDYVKLPPVIVIQLNRYKYTSKGRQ 318

Query: 492 KVXXXXXXXXTIWT*RLTRT-KSAPRXVSRYSLXAVISHMG 611
           K+         I      RT  S P     Y L AV  H G
Sbjct: 319 KLKTPMAYPREIPAKAFQRTNNSIPPPAEMYDLFAVTIHEG 359


>Z66511-5|CAA91317.1| 1095|Caenorhabditis elegans Hypothetical
           protein F07A11.4 protein.
          Length = 1095

 Score = 39.5 bits (88), Expect = 0.002
 Identities = 19/41 (46%), Positives = 24/41 (58%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSRE 189
           SI  D+F G+L S VQC  CDRVS   + F  L +P P  +
Sbjct: 566 SIFVDLFHGQLKSHVQCPNCDRVSITFDPFVYLPVPFPKNK 606



 Score = 34.3 bits (75), Expect = 0.084
 Identities = 18/51 (35%), Positives = 24/51 (47%)
 Frame = +3

Query: 315  LQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRF 467
            L   L  F   + LK +  + CS CK+     K   +  LP VL + LKRF
Sbjct: 910  LTQMLDLFSETERLKPEESWYCSTCKENVEATKKLQLYRLPPVLIIQLKRF 960


>U50193-6|AAL32262.1| 1175|Caenorhabditis elegans Cytokinesis defect
            protein 3, isoforma protein.
          Length = 1175

 Score = 35.5 bits (78), Expect = 0.037
 Identities = 20/52 (38%), Positives = 26/52 (50%)
 Frame = +3

Query: 312  SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRF 467
            SL+ C+  F   + L  D    C RC+K     K+  I  LP  L +HLKRF
Sbjct: 1029 SLEHCIEKFSCPETL--DAAIQCDRCEKKTMRDKVMTIWKLPKYLIIHLKRF 1078


>U50193-5|AAL32263.1| 1178|Caenorhabditis elegans Cytokinesis defect
            protein 3, isoformb protein.
          Length = 1178

 Score = 35.5 bits (78), Expect = 0.037
 Identities = 20/52 (38%), Positives = 26/52 (50%)
 Frame = +3

Query: 312  SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRF 467
            SL+ C+  F   + L  D    C RC+K     K+  I  LP  L +HLKRF
Sbjct: 1032 SLEHCIEKFSCPETL--DAAIQCDRCEKKTMRDKVMTIWKLPKYLIIHLKRF 1081


>AF469173-1|AAL79016.1| 1175|Caenorhabditis elegans ubiquitin
            c-terminal hydrolase protein.
          Length = 1175

 Score = 35.5 bits (78), Expect = 0.037
 Identities = 20/52 (38%), Positives = 26/52 (50%)
 Frame = +3

Query: 312  SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRF 467
            SL+ C+  F   + L  D    C RC+K     K+  I  LP  L +HLKRF
Sbjct: 1029 SLEHCIEKFSCPETL--DAAIQCDRCEKKTMRDKVMTIWKLPKYLIIHLKRF 1078


>U64844-5|AAM45362.1|  368|Caenorhabditis elegans Hypothetical
           protein T22F3.2b protein.
          Length = 368

 Score = 33.9 bits (74), Expect = 0.11
 Identities = 15/52 (28%), Positives = 30/52 (57%)
 Frame = +3

Query: 312 SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRF 467
           S+++ + A F+  ++ G   Y+CS+CKK  +      ++  P +L +H+ RF
Sbjct: 223 SIKELMQALFTESKIFG---YNCSKCKKKSDAPVKPTLLRAPQILLMHISRF 271


>U64844-4|AAB18307.1|  376|Caenorhabditis elegans Hypothetical
           protein T22F3.2a protein.
          Length = 376

 Score = 33.9 bits (74), Expect = 0.11
 Identities = 15/52 (28%), Positives = 30/52 (57%)
 Frame = +3

Query: 312 SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRF 467
           S+++ + A F+  ++ G   Y+CS+CKK  +      ++  P +L +H+ RF
Sbjct: 223 SIKELMQALFTESKIFG---YNCSKCKKKSDAPVKPTLLRAPQILLMHISRF 271


>Z92835-4|CAE54910.1| 1135|Caenorhabditis elegans Hypothetical
           protein H19N07.2c protein.
          Length = 1135

 Score = 30.7 bits (66), Expect = 1.0
 Identities = 14/41 (34%), Positives = 24/41 (58%)
 Frame = +1

Query: 73  ISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSREHL 195
           I ++F G + S ++CL  D  S+R E+F D+ L +   + L
Sbjct: 299 IPNLFRGNMKSYIKCLDVDYESSRTESFYDVQLNVLGMDSL 339


>Z92835-3|CAB07397.1| 1130|Caenorhabditis elegans Hypothetical
           protein H19N07.2b protein.
          Length = 1130

 Score = 30.7 bits (66), Expect = 1.0
 Identities = 14/41 (34%), Positives = 24/41 (58%)
 Frame = +1

Query: 73  ISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSREHL 195
           I ++F G + S ++CL  D  S+R E+F D+ L +   + L
Sbjct: 299 IPNLFRGNMKSYIKCLDVDYESSRTESFYDVQLNVLGMDSL 339


>Z92835-2|CAB07396.1| 1133|Caenorhabditis elegans Hypothetical
           protein H19N07.2a protein.
          Length = 1133

 Score = 30.7 bits (66), Expect = 1.0
 Identities = 14/41 (34%), Positives = 24/41 (58%)
 Frame = +1

Query: 73  ISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSREHL 195
           I ++F G + S ++CL  D  S+R E+F D+ L +   + L
Sbjct: 299 IPNLFRGNMKSYIKCLDVDYESSRTESFYDVQLNVLGMDSL 339


>Z81507-2|CAB04135.1|  388|Caenorhabditis elegans Hypothetical
           protein F18A11.2 protein.
          Length = 388

 Score = 28.7 bits (61), Expect = 4.2
 Identities = 13/47 (27%), Positives = 21/47 (44%)
 Frame = -3

Query: 221 MGCWQRSTAKCSRDGIGSDKSWNVSILVDTLSHIRH*TADSNFPSNT 81
           M  W+  T  C R  +    SW  ++ +D    IR+   +S + S T
Sbjct: 317 MDLWREMTVGCERPALSQIDSWKYTVPIDGFYFIRYGNHNSWYFSTT 363


>AF106582-1|AAC78217.3| 1424|Caenorhabditis elegans Hypothetical
           protein W05F2.7 protein.
          Length = 1424

 Score = 28.7 bits (61), Expect = 4.2
 Identities = 12/22 (54%), Positives = 14/22 (63%)
 Frame = +1

Query: 325 VWPPSSAPTNSKATTCTAAPAA 390
           +WP S AP  S+  T T APAA
Sbjct: 378 IWPASYAPNASRIVTGTMAPAA 399


>Z81482-5|CAB03956.3|  409|Caenorhabditis elegans Hypothetical
           protein C40H5.5 protein.
          Length = 409

 Score = 28.3 bits (60), Expect = 5.5
 Identities = 13/28 (46%), Positives = 16/28 (57%)
 Frame = +3

Query: 153 IPRLVAADPVPGTLGRAALPAAHAEPPR 236
           +P +VA  P P T   A  PAA  +PPR
Sbjct: 243 VPAVVAPPPPPPTTTTAPPPAAPEQPPR 270


>U72211-1|AAB97099.1|  409|Caenorhabditis elegans putative
           transcription factor TTX-3 protein.
          Length = 409

 Score = 28.3 bits (60), Expect = 5.5
 Identities = 13/28 (46%), Positives = 16/28 (57%)
 Frame = +3

Query: 153 IPRLVAADPVPGTLGRAALPAAHAEPPR 236
           +P +VA  P P T   A  PAA  +PPR
Sbjct: 243 VPAVVAPPPPPPTTTTAPPPAAPEQPPR 270


>Z69385-4|CAA93427.2| 1326|Caenorhabditis elegans Hypothetical protein
            ZK593.5 protein.
          Length = 1326

 Score = 27.9 bits (59), Expect = 7.3
 Identities = 17/48 (35%), Positives = 24/48 (50%)
 Frame = +1

Query: 94   KLLSAVQCLICDRVSTRIETFQDLSLPIPSREHLAVLRCQQPMLNHHA 237
            K  SAV  LI   ++   +T QDL L +    H   LR ++  +NH A
Sbjct: 1198 KRFSAVPGLISGPITLESQTRQDLLLKLIDNLHDESLRLRREEVNHQA 1245


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 13,875,699
Number of Sequences: 27780
Number of extensions: 241480
Number of successful extensions: 745
Number of sequences better than 10.0: 27
Number of HSP's better than 10.0 without gapping: 684
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 744
length of database: 12,740,198
effective HSP length: 79
effective length of database: 10,545,578
effective search space used: 1602927856
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -