SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30137.Seq
         (875 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z71262-12|CAA95808.1|  545|Caenorhabditis elegans Hypothetical p...   140   9e-34
U88171-1|AAB42251.2|  630|Caenorhabditis elegans Hypothetical pr...    32   0.47 
Z93381-6|CAB07609.1|  724|Caenorhabditis elegans Hypothetical pr...    31   1.1  
Z83218-8|CAB05693.1|  724|Caenorhabditis elegans Hypothetical pr...    31   1.1  
Z93381-5|CAB07608.2|  720|Caenorhabditis elegans Hypothetical pr...    31   1.4  
U40797-14|AAB37544.2|  200|Caenorhabditis elegans Hypothetical p...    31   1.4  
AC024841-3|AAK68542.1|  185|Caenorhabditis elegans Hypothetical ...    30   1.9  
AF078790-14|AAC26930.1|  335|Caenorhabditis elegans Hypothetical...    30   2.5  
Z83218-2|CAB05687.1|  705|Caenorhabditis elegans Hypothetical pr...    29   3.3  
AL021497-12|CAA16402.2| 1222|Caenorhabditis elegans Hypothetical...    29   5.8  
Z81529-11|CAB04297.1|  249|Caenorhabditis elegans Hypothetical p...    28   7.6  
Z81529-8|CAB04291.1|  249|Caenorhabditis elegans Hypothetical pr...    28   7.6  
Z50016-13|CAO82071.1|  211|Caenorhabditis elegans Hypothetical p...    28   7.6  
Z50016-12|CAA90317.3|  192|Caenorhabditis elegans Hypothetical p...    28   7.6  
U37430-4|AAB52675.1| 1616|Caenorhabditis elegans Vitellogenin st...    28   7.6  

>Z71262-12|CAA95808.1|  545|Caenorhabditis elegans Hypothetical
           protein F22D6.3a protein.
          Length = 545

 Score =  140 bits (340), Expect = 9e-34
 Identities = 65/109 (59%), Positives = 81/109 (74%)
 Frame = +1

Query: 511 WVHRLRRQGKSLAFLTLRDGTGYLQCVLHGLLCQTYNALVLSTESSVVLYGKLEAVPEGK 690
           WVHRLRRQGKSL FL LRDG G+LQCVL+  LCQ+Y+A+ LSTE+SV +YG ++A+P+GK
Sbjct: 129 WVHRLRRQGKSLMFLVLRDGYGFLQCVLNDKLCQSYDAVTLSTETSVQVYGIIKALPDGK 188

Query: 691 KAPGGHELTADYWGIDWTRTTRWCDAILNEEALPDVQLDHRXIMIRXEN 837
            AP GHELT DYW +         D +LNE A  DV LD+R ++IR EN
Sbjct: 189 SAPDGHELTVDYWEVIGKAPAGGIDNVLNESAGVDVMLDNRHLVIRGEN 237



 Score = 58.0 bits (134), Expect = 8e-09
 Identities = 32/83 (38%), Positives = 51/83 (61%), Gaps = 1/83 (1%)
 Frame = +2

Query: 263 DDTKDYDVAAKSQLKKIQKIWVRENYKAMDKAKAEEENTEKRSQN-LDEAKKILLQEDPS 439
           ++ + ++ AAK+ +KK  K +  E  K ++KA   E+  E+     L+EAKKI    D S
Sbjct: 46  EEGESWEPAAKAAIKKAVKKYEAE-VKKLEKAGCREKEAEEAQHAALEEAKKITFSLDKS 104

Query: 440 LPKATVVKICETTEHRGQRICIR 508
           LP+A V+KI E+ +HR QR+ I+
Sbjct: 105 LPEAKVIKIGESVQHRDQRVSIK 127


>U88171-1|AAB42251.2|  630|Caenorhabditis elegans Hypothetical
           protein F25F8.1 protein.
          Length = 630

 Score = 32.3 bits (70), Expect = 0.47
 Identities = 15/33 (45%), Positives = 20/33 (60%)
 Frame = +1

Query: 94  STCRTLETLACPRYIPRIRMAMTIQVMVRKRNH 192
           S CR +E +ACPR  P+I M+ T  + V  R H
Sbjct: 404 SNCRKVEVIACPR-DPKIEMSRTRWITVGPRGH 435


>Z93381-6|CAB07609.1|  724|Caenorhabditis elegans Hypothetical
           protein C31A11.1 protein.
          Length = 724

 Score = 31.1 bits (67), Expect = 1.1
 Identities = 13/28 (46%), Positives = 19/28 (67%), Gaps = 1/28 (3%)
 Frame = +2

Query: 581 YSAFYM-VYYVRPTML*SYLRSHLWSCM 661
           YS+F + +YY  PT L SY+ +  WSC+
Sbjct: 637 YSSFQLFMYYAVPTTLLSYIFAFFWSCL 664


>Z83218-8|CAB05693.1|  724|Caenorhabditis elegans Hypothetical
           protein C31A11.1 protein.
          Length = 724

 Score = 31.1 bits (67), Expect = 1.1
 Identities = 13/28 (46%), Positives = 19/28 (67%), Gaps = 1/28 (3%)
 Frame = +2

Query: 581 YSAFYM-VYYVRPTML*SYLRSHLWSCM 661
           YS+F + +YY  PT L SY+ +  WSC+
Sbjct: 637 YSSFQLFMYYAVPTTLLSYIFAFFWSCL 664


>Z93381-5|CAB07608.2|  720|Caenorhabditis elegans Hypothetical
           protein F28G4.5 protein.
          Length = 720

 Score = 30.7 bits (66), Expect = 1.4
 Identities = 13/28 (46%), Positives = 18/28 (64%), Gaps = 1/28 (3%)
 Frame = +2

Query: 581 YSAFYM-VYYVRPTML*SYLRSHLWSCM 661
           YS F + +YY  PT L SY+ +  WSC+
Sbjct: 629 YSTFQLFMYYAVPTTLLSYIFAFFWSCL 656


>U40797-14|AAB37544.2|  200|Caenorhabditis elegans Hypothetical
           protein C28C12.1 protein.
          Length = 200

 Score = 30.7 bits (66), Expect = 1.4
 Identities = 12/28 (42%), Positives = 20/28 (71%)
 Frame = +2

Query: 359 KAEEENTEKRSQNLDEAKKILLQEDPSL 442
           K +EE TEK+   + E++K +L+ED +L
Sbjct: 160 KTDEEGTEKKEPTMTESRKEMLREDDTL 187


>AC024841-3|AAK68542.1|  185|Caenorhabditis elegans Hypothetical
           protein Y59H11AM.4 protein.
          Length = 185

 Score = 30.3 bits (65), Expect = 1.9
 Identities = 20/61 (32%), Positives = 31/61 (50%)
 Frame = +2

Query: 260 KDDTKDYDVAAKSQLKKIQKIWVRENYKAMDKAKAEEENTEKRSQNLDEAKKILLQEDPS 439
           K++ KD +   ++  KKI +    E     DK   EE   EK+   L ++KK  L+ED +
Sbjct: 123 KNEEKDAEAPVENDDKKISE----EGINKTDKT--EEPELEKKKSELSDSKKERLREDDT 176

Query: 440 L 442
           L
Sbjct: 177 L 177


>AF078790-14|AAC26930.1|  335|Caenorhabditis elegans Hypothetical
           protein F36H12.3 protein.
          Length = 335

 Score = 29.9 bits (64), Expect = 2.5
 Identities = 20/63 (31%), Positives = 34/63 (53%)
 Frame = +2

Query: 260 KDDTKDYDVAAKSQLKKIQKIWVRENYKAMDKAKAEEENTEKRSQNLDEAKKILLQEDPS 439
           K++ KD D   K + KK +K   ++  K  +K K EE+  EK+ +  ++ KK+  +  P 
Sbjct: 166 KEEKKD-DKEEKKEEKKEEKKEEKKEEKKEEK-KEEEKKEEKKEEKKEDEKKV--EPKPG 221

Query: 440 LPK 448
            PK
Sbjct: 222 EPK 224



 Score = 29.1 bits (62), Expect = 4.4
 Identities = 21/59 (35%), Positives = 27/59 (45%), Gaps = 1/59 (1%)
 Frame = +2

Query: 260 KDDTKDYDVAAKSQLKKIQKIWVRENYKAMDKA-KAEEENTEKRSQNLDEAKKILLQED 433
           K D KD     K + KK  K   +E  K   K  K EE+  EK+ +   E KK   +ED
Sbjct: 154 KSDNKDDKDDEKKEEKKDDKEEKKEEKKEEKKEEKKEEKKEEKKEEEKKEEKKEEKKED 212


>Z83218-2|CAB05687.1|  705|Caenorhabditis elegans Hypothetical
           protein C31A11.5 protein.
          Length = 705

 Score = 29.5 bits (63), Expect = 3.3
 Identities = 12/28 (42%), Positives = 19/28 (67%), Gaps = 1/28 (3%)
 Frame = +2

Query: 581 YSAFYM-VYYVRPTML*SYLRSHLWSCM 661
           YS+F + +YY  PT + SY+ +  WSC+
Sbjct: 622 YSSFQIFMYYAVPTTVLSYIFAFFWSCL 649


>AL021497-12|CAA16402.2| 1222|Caenorhabditis elegans Hypothetical
           protein Y51A2D.15 protein.
          Length = 1222

 Score = 28.7 bits (61), Expect = 5.8
 Identities = 12/30 (40%), Positives = 21/30 (70%)
 Frame = +2

Query: 329 RENYKAMDKAKAEEENTEKRSQNLDEAKKI 418
           +EN K  D+ +  ++ ++KRSQNLDE + +
Sbjct: 852 QENTKLRDELQEMQKMSKKRSQNLDELENM 881


>Z81529-11|CAB04297.1|  249|Caenorhabditis elegans Hypothetical
           protein F35E8.13 protein.
          Length = 249

 Score = 28.3 bits (60), Expect = 7.6
 Identities = 14/60 (23%), Positives = 27/60 (45%)
 Frame = -2

Query: 718 LSAHDHPEPSFPRAQPLIFHTRPQMTP*IGLEHCRSDIVNHVERTVGTQCHHAGSGMPEI 539
           ++A  +P P   + +PL  +T    TP   ++  ++   +   RT G  C  +G   P +
Sbjct: 60  VAADGYPSPGRDQQRPLACYTTATATPAAVVQDMKNAAQSTCPRTCGLCCQTSGYNCPNV 119


>Z81529-8|CAB04291.1|  249|Caenorhabditis elegans Hypothetical
           protein F35E8.10 protein.
          Length = 249

 Score = 28.3 bits (60), Expect = 7.6
 Identities = 14/60 (23%), Positives = 27/60 (45%)
 Frame = -2

Query: 718 LSAHDHPEPSFPRAQPLIFHTRPQMTP*IGLEHCRSDIVNHVERTVGTQCHHAGSGMPEI 539
           ++A  +P P   + +PL  +T    TP   ++  ++   +   RT G  C  +G   P +
Sbjct: 60  VAADGYPSPGRDQQRPLACYTTATATPAAVVQDMKNAAQSTCPRTCGLCCQTSGYNCPNV 119


>Z50016-13|CAO82071.1|  211|Caenorhabditis elegans Hypothetical
           protein T21C12.4b protein.
          Length = 211

 Score = 28.3 bits (60), Expect = 7.6
 Identities = 17/70 (24%), Positives = 33/70 (47%)
 Frame = +2

Query: 293 KSQLKKIQKIWVRENYKAMDKAKAEEENTEKRSQNLDEAKKILLQEDPSLPKATVVKICE 472
           KS  K I K   R     + ++   ++  EK+  ++ E K +   +D  +P     K  E
Sbjct: 141 KSNKKSISKKSDRSKVSKVKRSPKTDKELEKKPSSIYERKDVDGHDDLKVPNMRSRKHSE 200

Query: 473 TTEHRGQRIC 502
            +++RG ++C
Sbjct: 201 NSKNRG-KVC 209


>Z50016-12|CAA90317.3|  192|Caenorhabditis elegans Hypothetical
           protein T21C12.4a protein.
          Length = 192

 Score = 28.3 bits (60), Expect = 7.6
 Identities = 17/70 (24%), Positives = 33/70 (47%)
 Frame = +2

Query: 293 KSQLKKIQKIWVRENYKAMDKAKAEEENTEKRSQNLDEAKKILLQEDPSLPKATVVKICE 472
           KS  K I K   R     + ++   ++  EK+  ++ E K +   +D  +P     K  E
Sbjct: 122 KSNKKSISKKSDRSKVSKVKRSPKTDKELEKKPSSIYERKDVDGHDDLKVPNMRSRKHSE 181

Query: 473 TTEHRGQRIC 502
            +++RG ++C
Sbjct: 182 NSKNRG-KVC 190


>U37430-4|AAB52675.1| 1616|Caenorhabditis elegans Vitellogenin
            structural genes (yolk protein genes) protein 1 protein.
          Length = 1616

 Score = 28.3 bits (60), Expect = 7.6
 Identities = 22/75 (29%), Positives = 34/75 (45%)
 Frame = +2

Query: 293  KSQLKKIQKIWVRENYKAMDKAKAEEENTEKRSQNLDEAKKILLQEDPSLPKATVVKICE 472
            K+  K  ++ +  E Y   +    E+ENT K+ +N    KK  L E   + K    +IC 
Sbjct: 1489 KNYRKYDERKYESEEYSFEETYDYEQENTNKKQKNQRSQKKSDLVEKTQI-KEFSHRICF 1547

Query: 473  TTEHRGQRICIRDGY 517
            + E   +  C R GY
Sbjct: 1548 SVEPVAE--CRRRGY 1560


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 20,048,469
Number of Sequences: 27780
Number of extensions: 432082
Number of successful extensions: 1221
Number of sequences better than 10.0: 15
Number of HSP's better than 10.0 without gapping: 1157
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1219
length of database: 12,740,198
effective HSP length: 81
effective length of database: 10,490,018
effective search space used: 2202903780
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -