SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30136.Seq
         (884 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U53153-2|AAQ91899.1|  422|Caenorhabditis elegans Hypothetical pr...    32   0.63 
U53153-1|AAC69039.4|  715|Caenorhabditis elegans Hypothetical pr...    32   0.63 
AF038605-2|AAB92020.1|  698|Caenorhabditis elegans Hypothetical ...    31   0.83 
Z98866-8|CAB11562.2|  425|Caenorhabditis elegans Hypothetical pr...    29   4.4  
Z70686-12|CAB54289.1| 2584|Caenorhabditis elegans Hypothetical p...    28   7.7  
Z70686-11|CAA94615.1| 2606|Caenorhabditis elegans Hypothetical p...    28   7.7  
Z70310-9|CAB54294.1| 2584|Caenorhabditis elegans Hypothetical pr...    28   7.7  
Z70310-8|CAA94370.1| 2606|Caenorhabditis elegans Hypothetical pr...    28   7.7  
AL110501-1|CAB54509.1| 2129|Caenorhabditis elegans Hypothetical ...    28   7.7  
AC006620-1|AAF39780.1|  754|Caenorhabditis elegans Hypothetical ...    28   7.7  

>U53153-2|AAQ91899.1|  422|Caenorhabditis elegans Hypothetical
           protein T19A5.3b protein.
          Length = 422

 Score = 31.9 bits (69), Expect = 0.63
 Identities = 16/31 (51%), Positives = 18/31 (58%), Gaps = 1/31 (3%)
 Frame = +2

Query: 32  TAALPPRTTRIHNPPTTPI-RPNNSTLTAMA 121
           T  LPP TT I+ PPTT   RP  +T T  A
Sbjct: 216 TTTLPPETTTIYVPPTTASRRPTTTTTTTEA 246


>U53153-1|AAC69039.4|  715|Caenorhabditis elegans Hypothetical
           protein T19A5.3a protein.
          Length = 715

 Score = 31.9 bits (69), Expect = 0.63
 Identities = 16/31 (51%), Positives = 18/31 (58%), Gaps = 1/31 (3%)
 Frame = +2

Query: 32  TAALPPRTTRIHNPPTTPI-RPNNSTLTAMA 121
           T  LPP TT I+ PPTT   RP  +T T  A
Sbjct: 284 TTTLPPETTTIYVPPTTASRRPTTTTTTTEA 314


>AF038605-2|AAB92020.1|  698|Caenorhabditis elegans Hypothetical
           protein C02B10.5 protein.
          Length = 698

 Score = 31.5 bits (68), Expect = 0.83
 Identities = 20/53 (37%), Positives = 27/53 (50%)
 Frame = +1

Query: 664 FPGPSXYNVVTGKTPGVTPL*SPCRHXPLSASWVISXXGPHRLALXQQLRXPG 822
           FP P+ Y +  G TPG  P+ +P +    S S+  S   P  +A  QQ R PG
Sbjct: 434 FP-PNPYGMHPGMTPGGYPMSAPGKMPFGSPSFPQSAPSPAAMAAMQQGRMPG 485


>Z98866-8|CAB11562.2|  425|Caenorhabditis elegans Hypothetical
           protein Y49E10.10 protein.
          Length = 425

 Score = 29.1 bits (62), Expect = 4.4
 Identities = 16/35 (45%), Positives = 18/35 (51%), Gaps = 1/35 (2%)
 Frame = +2

Query: 5   PVTEQQSPHTA-ALPPRTTRIHNPPTTPIRPNNST 106
           P TE   P T  A PP TT+   PPTT   P  +T
Sbjct: 170 PTTEAPPPPTTKAPPPPTTKAPPPPTTKAPPPPTT 204



 Score = 28.3 bits (60), Expect = 7.7
 Identities = 14/32 (43%), Positives = 16/32 (50%)
 Frame = +2

Query: 11  TEQQSPHTAALPPRTTRIHNPPTTPIRPNNST 106
           T    P T A PP TT+   PPTT   P  +T
Sbjct: 165 TTAAEPTTEAPPPPTTKAPPPPTTKAPPPPTT 196


>Z70686-12|CAB54289.1| 2584|Caenorhabditis elegans Hypothetical
            protein R11A8.7b protein.
          Length = 2584

 Score = 28.3 bits (60), Expect = 7.7
 Identities = 11/28 (39%), Positives = 17/28 (60%)
 Frame = +1

Query: 628  PVPNSPLVSRITFPGPSXYNVVTGKTPG 711
            P+P+ P  + +T P P+  + VT K PG
Sbjct: 990  PIPSGPKKTSLTAPNPADTSDVTTKQPG 1017


>Z70686-11|CAA94615.1| 2606|Caenorhabditis elegans Hypothetical
            protein R11A8.7a protein.
          Length = 2606

 Score = 28.3 bits (60), Expect = 7.7
 Identities = 11/28 (39%), Positives = 17/28 (60%)
 Frame = +1

Query: 628  PVPNSPLVSRITFPGPSXYNVVTGKTPG 711
            P+P+ P  + +T P P+  + VT K PG
Sbjct: 990  PIPSGPKKTSLTAPNPADTSDVTTKQPG 1017


>Z70310-9|CAB54294.1| 2584|Caenorhabditis elegans Hypothetical protein
            R11A8.7b protein.
          Length = 2584

 Score = 28.3 bits (60), Expect = 7.7
 Identities = 11/28 (39%), Positives = 17/28 (60%)
 Frame = +1

Query: 628  PVPNSPLVSRITFPGPSXYNVVTGKTPG 711
            P+P+ P  + +T P P+  + VT K PG
Sbjct: 990  PIPSGPKKTSLTAPNPADTSDVTTKQPG 1017


>Z70310-8|CAA94370.1| 2606|Caenorhabditis elegans Hypothetical protein
            R11A8.7a protein.
          Length = 2606

 Score = 28.3 bits (60), Expect = 7.7
 Identities = 11/28 (39%), Positives = 17/28 (60%)
 Frame = +1

Query: 628  PVPNSPLVSRITFPGPSXYNVVTGKTPG 711
            P+P+ P  + +T P P+  + VT K PG
Sbjct: 990  PIPSGPKKTSLTAPNPADTSDVTTKQPG 1017


>AL110501-1|CAB54509.1| 2129|Caenorhabditis elegans Hypothetical
            protein Y79H2A.3a protein.
          Length = 2129

 Score = 28.3 bits (60), Expect = 7.7
 Identities = 10/20 (50%), Positives = 11/20 (55%)
 Frame = +1

Query: 61   YSQPAYNSYPPQQQYSNSYG 120
            Y Q  Y   PPQ QY+  YG
Sbjct: 2034 YQQQMYQQQPPQPQYAQQYG 2053


>AC006620-1|AAF39780.1|  754|Caenorhabditis elegans Hypothetical
           protein C51G7.3 protein.
          Length = 754

 Score = 28.3 bits (60), Expect = 7.7
 Identities = 10/20 (50%), Positives = 11/20 (55%)
 Frame = +1

Query: 61  YSQPAYNSYPPQQQYSNSYG 120
           Y Q  Y   PPQ QY+  YG
Sbjct: 659 YQQQMYQQQPPQPQYAQQYG 678


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 16,930,236
Number of Sequences: 27780
Number of extensions: 312700
Number of successful extensions: 803
Number of sequences better than 10.0: 10
Number of HSP's better than 10.0 without gapping: 711
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 801
length of database: 12,740,198
effective HSP length: 81
effective length of database: 10,490,018
effective search space used: 2234373834
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -