SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30135.Seq
         (856 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z81584-6|CAB04678.1|  376|Caenorhabditis elegans Hypothetical pr...   185   3e-47
Z81584-5|CAB04675.1|  376|Caenorhabditis elegans Hypothetical pr...   185   3e-47
Z81584-4|CAB04676.1|  376|Caenorhabditis elegans Hypothetical pr...   185   3e-47
X16799-1|CAA34720.1|  376|Caenorhabditis elegans actin protein.       185   3e-47
X16798-1|CAA34719.1|  375|Caenorhabditis elegans actin protein.       185   3e-47
X16797-1|CAA34718.1|  376|Caenorhabditis elegans actin protein.       185   3e-47
X16796-1|CAA34717.1|  376|Caenorhabditis elegans actin protein.       185   3e-47
U64601-7|AAK77622.1|  332|Caenorhabditis elegans Actin protein 4...   185   3e-47
U64601-6|AAT92068.1|  362|Caenorhabditis elegans Actin protein 4...   185   3e-47
U64601-5|AAB04575.1|  376|Caenorhabditis elegans Actin protein 4...   185   3e-47
Z83241-1|CAB05817.1|  375|Caenorhabditis elegans Hypothetical pr...   181   5e-46
J01044-1|AAA27889.1|   86|Caenorhabditis elegans protein ( C.ele...   128   4e-30
J01042-1|AAA27887.1|   86|Caenorhabditis elegans protein ( C.ele...   128   4e-30
J01046-1|AAA27890.1|   86|Caenorhabditis elegans protein ( C.ele...   127   9e-30
J01043-1|AAA27888.1|   83|Caenorhabditis elegans protein ( C.ele...   127   9e-30
AL132949-19|CAB70110.2|  374|Caenorhabditis elegans Hypothetical...   125   4e-29
AC024200-9|AAF36012.1|  425|Caenorhabditis elegans Arp2/3 comple...   101   5e-22
Z71181-1|CAA94894.1|  395|Caenorhabditis elegans Hypothetical pr...   100   3e-21
AC006833-3|AAF60947.2|  436|Caenorhabditis elegans Hypothetical ...    73   3e-13
U40799-8|AAA81487.1|  552|Caenorhabditis elegans Hypothetical pr...    39   0.005
Z46676-5|CAA86667.3|  418|Caenorhabditis elegans Hypothetical pr...    37   0.016
U24189-2|AAC47513.1|  418|Caenorhabditis elegans actin-related p...    37   0.016
Z70287-6|CAH04747.1|  443|Caenorhabditis elegans Hypothetical pr...    33   0.20 
U51998-7|AAA96080.2|  769|Caenorhabditis elegans Hypothetical pr...    33   0.34 
U51998-6|ABS83845.1|  825|Caenorhabditis elegans Hypothetical pr...    33   0.34 
AC006797-1|AAF60743.1| 1079|Caenorhabditis elegans Hypothetical ...    32   0.60 
Z49968-1|CAA90258.2|  499|Caenorhabditis elegans Hypothetical pr...    31   0.79 
U64835-5|AAG24196.1|  592|Caenorhabditis elegans Hypothetical pr...    31   0.79 
Z81479-1|CAB03944.1| 1043|Caenorhabditis elegans Hypothetical pr...    31   1.0  
Z81044-5|CAE17706.2|  460|Caenorhabditis elegans Hypothetical pr...    30   1.8  
U51998-5|AAL00856.2|  648|Caenorhabditis elegans Hypothetical pr...    30   1.8  
Z68317-3|CAA92687.1|  599|Caenorhabditis elegans Hypothetical pr...    30   2.4  
U40797-12|AAN84858.1|  230|Caenorhabditis elegans Gex interactin...    29   3.2  
U40797-11|AAN84857.1|  313|Caenorhabditis elegans Gex interactin...    29   3.2  
U40797-10|AAK95871.1|  617|Caenorhabditis elegans Gex interactin...    29   3.2  
Z92815-4|CAB07294.2| 2175|Caenorhabditis elegans Hypothetical pr...    29   5.6  
Z66561-7|CAB54206.2|  419|Caenorhabditis elegans Hypothetical pr...    29   5.6  
U50197-2|AAA91255.2|  624|Caenorhabditis elegans Hypothetical pr...    29   5.6  
AF304127-1|AAG50240.1|  419|Caenorhabditis elegans innexin protein.    29   5.6  
Z81138-5|CAB63320.3| 1278|Caenorhabditis elegans Hypothetical pr...    28   7.4  
U41263-13|AAC24428.2| 1844|Caenorhabditis elegans Hypothetical p...    28   7.4  
AF188477-1|AAF01458.1| 1418|Caenorhabditis elegans phospholipase...    28   7.4  
AF179426-1|AAF05701.1| 1431|Caenorhabditis elegans phospholipase...    28   7.4  
AF068714-6|AAL77167.1| 1419|Caenorhabditis elegans Egg laying de...    28   7.4  
AF068714-5|AAL77168.1| 1431|Caenorhabditis elegans Egg laying de...    28   7.4  
Z82258-1|CAB05122.2|  906|Caenorhabditis elegans Hypothetical pr...    28   9.7  
Z74473-5|CAI79195.1|  245|Caenorhabditis elegans Hypothetical pr...    28   9.7  
Z49909-12|CAA90114.2|  121|Caenorhabditis elegans Hypothetical p...    28   9.7  
AF535160-1|AAN33048.1|  468|Caenorhabditis elegans UNC-34 protein.     28   9.7  
AF038608-17|AAC25822.2|  425|Caenorhabditis elegans Hypothetical...    28   9.7  
AF025453-5|AAY55851.1|  279|Caenorhabditis elegans Hypothetical ...    28   9.7  
AC025722-6|AAO12398.1|  310|Caenorhabditis elegans Uncoordinated...    28   9.7  
AC025722-5|AAO12397.1|  454|Caenorhabditis elegans Uncoordinated...    28   9.7  

>Z81584-6|CAB04678.1|  376|Caenorhabditis elegans Hypothetical
           protein T04C12.6 protein.
          Length = 376

 Score =  185 bits (451), Expect = 3e-47
 Identities = 85/85 (100%), Positives = 85/85 (100%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 434
           AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE
Sbjct: 59  AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 118

Query: 435 KMTQIMFETFNTPAMYVAIQAVLSL 509
           KMTQIMFETFNTPAMYVAIQAVLSL
Sbjct: 119 KMTQIMFETFNTPAMYVAIQAVLSL 143



 Score =  129 bits (311), Expect = 3e-30
 Identities = 63/78 (80%), Positives = 66/78 (84%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YASGRTTG+VLDSGDGV+HTVPIYEGYALPHAILRLD +   LTDYLMKILTERGYSF T
Sbjct: 144 YASGRTTGVVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTT 203

Query: 689 NAXREIRS*TFKEKLCYV 742
            A REI     KEKLCYV
Sbjct: 204 TAEREIVR-DIKEKLCYV 220



 Score =  128 bits (310), Expect = 4e-30
 Identities = 58/62 (93%), Positives = 61/62 (98%)
 Frame = +1

Query: 82  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEHR 261
           MCD+EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE +
Sbjct: 1   MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 262 AK 267
           +K
Sbjct: 61  SK 62


>Z81584-5|CAB04675.1|  376|Caenorhabditis elegans Hypothetical
           protein T04C12.5 protein.
          Length = 376

 Score =  185 bits (451), Expect = 3e-47
 Identities = 85/85 (100%), Positives = 85/85 (100%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 434
           AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE
Sbjct: 59  AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 118

Query: 435 KMTQIMFETFNTPAMYVAIQAVLSL 509
           KMTQIMFETFNTPAMYVAIQAVLSL
Sbjct: 119 KMTQIMFETFNTPAMYVAIQAVLSL 143



 Score =  129 bits (312), Expect = 2e-30
 Identities = 64/78 (82%), Positives = 66/78 (84%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YASGRTTGIVLDSGDGV+HTVPIYEGYALPHAILRLD +   LTDYLMKILTERGYSF T
Sbjct: 144 YASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTT 203

Query: 689 NAXREIRS*TFKEKLCYV 742
            A REI     KEKLCYV
Sbjct: 204 TAEREIVR-DIKEKLCYV 220



 Score =  127 bits (307), Expect = 9e-30
 Identities = 57/62 (91%), Positives = 61/62 (98%)
 Frame = +1

Query: 82  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEHR 261
           MCD++VAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE +
Sbjct: 1   MCDDDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 262 AK 267
           +K
Sbjct: 61  SK 62


>Z81584-4|CAB04676.1|  376|Caenorhabditis elegans Hypothetical
           protein T04C12.4 protein.
          Length = 376

 Score =  185 bits (451), Expect = 3e-47
 Identities = 85/85 (100%), Positives = 85/85 (100%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 434
           AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE
Sbjct: 59  AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 118

Query: 435 KMTQIMFETFNTPAMYVAIQAVLSL 509
           KMTQIMFETFNTPAMYVAIQAVLSL
Sbjct: 119 KMTQIMFETFNTPAMYVAIQAVLSL 143



 Score =  129 bits (311), Expect = 3e-30
 Identities = 63/78 (80%), Positives = 66/78 (84%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YASGRTTG+VLDSGDGV+HTVPIYEGYALPHAILRLD +   LTDYLMKILTERGYSF T
Sbjct: 144 YASGRTTGVVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTT 203

Query: 689 NAXREIRS*TFKEKLCYV 742
            A REI     KEKLCYV
Sbjct: 204 TAEREIVR-DIKEKLCYV 220



 Score =  128 bits (310), Expect = 4e-30
 Identities = 58/62 (93%), Positives = 61/62 (98%)
 Frame = +1

Query: 82  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEHR 261
           MCD+EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE +
Sbjct: 1   MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 262 AK 267
           +K
Sbjct: 61  SK 62


>X16799-1|CAA34720.1|  376|Caenorhabditis elegans actin protein.
          Length = 376

 Score =  185 bits (451), Expect = 3e-47
 Identities = 85/85 (100%), Positives = 85/85 (100%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 434
           AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE
Sbjct: 59  AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 118

Query: 435 KMTQIMFETFNTPAMYVAIQAVLSL 509
           KMTQIMFETFNTPAMYVAIQAVLSL
Sbjct: 119 KMTQIMFETFNTPAMYVAIQAVLSL 143



 Score =  129 bits (311), Expect = 3e-30
 Identities = 63/78 (80%), Positives = 66/78 (84%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YASGRTTG+VLDSGDGV+HTVPIYEGYALPHAILRLD +   LTDYLMKILTERGYSF T
Sbjct: 144 YASGRTTGVVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTT 203

Query: 689 NAXREIRS*TFKEKLCYV 742
            A REI     KEKLCYV
Sbjct: 204 TAEREIVR-DIKEKLCYV 220



 Score =  128 bits (310), Expect = 4e-30
 Identities = 58/62 (93%), Positives = 61/62 (98%)
 Frame = +1

Query: 82  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEHR 261
           MCD+EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE +
Sbjct: 1   MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 262 AK 267
           +K
Sbjct: 61  SK 62


>X16798-1|CAA34719.1|  375|Caenorhabditis elegans actin protein.
          Length = 375

 Score =  185 bits (451), Expect = 3e-47
 Identities = 85/85 (100%), Positives = 85/85 (100%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 434
           AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE
Sbjct: 59  AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 118

Query: 435 KMTQIMFETFNTPAMYVAIQAVLSL 509
           KMTQIMFETFNTPAMYVAIQAVLSL
Sbjct: 119 KMTQIMFETFNTPAMYVAIQAVLSL 143



 Score =  129 bits (311), Expect = 3e-30
 Identities = 63/78 (80%), Positives = 66/78 (84%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YASGRTTG+VLDSGDGV+HTVPIYEGYALPHAILRLD +   LTDYLMKILTERGYSF T
Sbjct: 144 YASGRTTGVVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTT 203

Query: 689 NAXREIRS*TFKEKLCYV 742
            A REI     KEKLCYV
Sbjct: 204 TAEREIVR-DIKEKLCYV 220



 Score =  128 bits (310), Expect = 4e-30
 Identities = 58/62 (93%), Positives = 61/62 (98%)
 Frame = +1

Query: 82  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEHR 261
           MCD+EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE +
Sbjct: 1   MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 262 AK 267
           +K
Sbjct: 61  SK 62


>X16797-1|CAA34718.1|  376|Caenorhabditis elegans actin protein.
          Length = 376

 Score =  185 bits (451), Expect = 3e-47
 Identities = 85/85 (100%), Positives = 85/85 (100%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 434
           AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE
Sbjct: 59  AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 118

Query: 435 KMTQIMFETFNTPAMYVAIQAVLSL 509
           KMTQIMFETFNTPAMYVAIQAVLSL
Sbjct: 119 KMTQIMFETFNTPAMYVAIQAVLSL 143



 Score =  129 bits (312), Expect = 2e-30
 Identities = 64/78 (82%), Positives = 66/78 (84%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YASGRTTGIVLDSGDGV+HTVPIYEGYALPHAILRLD +   LTDYLMKILTERGYSF T
Sbjct: 144 YASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTT 203

Query: 689 NAXREIRS*TFKEKLCYV 742
            A REI     KEKLCYV
Sbjct: 204 TAEREIVR-DIKEKLCYV 220



 Score =  126 bits (303), Expect = 3e-29
 Identities = 55/62 (88%), Positives = 61/62 (98%)
 Frame = +1

Query: 82  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEHR 261
           MCD++VAAL++DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE +
Sbjct: 1   MCDDDVAALILDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 262 AK 267
           +K
Sbjct: 61  SK 62


>X16796-1|CAA34717.1|  376|Caenorhabditis elegans actin protein.
          Length = 376

 Score =  185 bits (451), Expect = 3e-47
 Identities = 85/85 (100%), Positives = 85/85 (100%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 434
           AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE
Sbjct: 59  AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 118

Query: 435 KMTQIMFETFNTPAMYVAIQAVLSL 509
           KMTQIMFETFNTPAMYVAIQAVLSL
Sbjct: 119 KMTQIMFETFNTPAMYVAIQAVLSL 143



 Score =  129 bits (311), Expect = 3e-30
 Identities = 63/78 (80%), Positives = 66/78 (84%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YASGRTTG+VLDSGDGV+HTVPIYEGYALPHAILRLD +   LTDYLMKILTERGYSF T
Sbjct: 144 YASGRTTGVVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTT 203

Query: 689 NAXREIRS*TFKEKLCYV 742
            A REI     KEKLCYV
Sbjct: 204 TAEREIVR-DIKEKLCYV 220



 Score =  128 bits (310), Expect = 4e-30
 Identities = 58/62 (93%), Positives = 61/62 (98%)
 Frame = +1

Query: 82  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEHR 261
           MCD+EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE +
Sbjct: 1   MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 262 AK 267
           +K
Sbjct: 61  SK 62


>U64601-7|AAK77622.1|  332|Caenorhabditis elegans Actin protein 4,
           isoform b protein.
          Length = 332

 Score =  185 bits (451), Expect = 3e-47
 Identities = 85/85 (100%), Positives = 85/85 (100%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 434
           AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE
Sbjct: 15  AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 74

Query: 435 KMTQIMFETFNTPAMYVAIQAVLSL 509
           KMTQIMFETFNTPAMYVAIQAVLSL
Sbjct: 75  KMTQIMFETFNTPAMYVAIQAVLSL 99



 Score =  129 bits (311), Expect = 3e-30
 Identities = 63/78 (80%), Positives = 66/78 (84%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YASGRTTG+VLDSGDGV+HTVPIYEGYALPHAILRLD +   LTDYLMKILTERGYSF T
Sbjct: 100 YASGRTTGVVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTT 159

Query: 689 NAXREIRS*TFKEKLCYV 742
            A REI     KEKLCYV
Sbjct: 160 TAEREIVR-DIKEKLCYV 176



 Score = 35.9 bits (79), Expect = 0.037
 Identities = 15/18 (83%), Positives = 17/18 (94%)
 Frame = +1

Query: 214 MVGMGQKDSYVGDEHRAK 267
           MVGMGQKDSYVGDE ++K
Sbjct: 1   MVGMGQKDSYVGDEAQSK 18


>U64601-6|AAT92068.1|  362|Caenorhabditis elegans Actin protein 4,
           isoform c protein.
          Length = 362

 Score =  185 bits (451), Expect = 3e-47
 Identities = 85/85 (100%), Positives = 85/85 (100%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 434
           AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE
Sbjct: 45  AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 104

Query: 435 KMTQIMFETFNTPAMYVAIQAVLSL 509
           KMTQIMFETFNTPAMYVAIQAVLSL
Sbjct: 105 KMTQIMFETFNTPAMYVAIQAVLSL 129



 Score =  129 bits (311), Expect = 3e-30
 Identities = 63/78 (80%), Positives = 66/78 (84%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YASGRTTG+VLDSGDGV+HTVPIYEGYALPHAILRLD +   LTDYLMKILTERGYSF T
Sbjct: 130 YASGRTTGVVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTT 189

Query: 689 NAXREIRS*TFKEKLCYV 742
            A REI     KEKLCYV
Sbjct: 190 TAEREIVR-DIKEKLCYV 206



 Score = 90.2 bits (214), Expect = 2e-18
 Identities = 40/44 (90%), Positives = 43/44 (97%)
 Frame = +1

Query: 136 KAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEHRAK 267
           +AGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE ++K
Sbjct: 5   RAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 48


>U64601-5|AAB04575.1|  376|Caenorhabditis elegans Actin protein 4,
           isoform a protein.
          Length = 376

 Score =  185 bits (451), Expect = 3e-47
 Identities = 85/85 (100%), Positives = 85/85 (100%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 434
           AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE
Sbjct: 59  AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 118

Query: 435 KMTQIMFETFNTPAMYVAIQAVLSL 509
           KMTQIMFETFNTPAMYVAIQAVLSL
Sbjct: 119 KMTQIMFETFNTPAMYVAIQAVLSL 143



 Score =  129 bits (311), Expect = 3e-30
 Identities = 63/78 (80%), Positives = 66/78 (84%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YASGRTTG+VLDSGDGV+HTVPIYEGYALPHAILRLD +   LTDYLMKILTERGYSF T
Sbjct: 144 YASGRTTGVVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTT 203

Query: 689 NAXREIRS*TFKEKLCYV 742
            A REI     KEKLCYV
Sbjct: 204 TAEREIVR-DIKEKLCYV 220



 Score =  128 bits (310), Expect = 4e-30
 Identities = 58/62 (93%), Positives = 61/62 (98%)
 Frame = +1

Query: 82  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEHR 261
           MCD+EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE +
Sbjct: 1   MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 262 AK 267
           +K
Sbjct: 61  SK 62


>Z83241-1|CAB05817.1|  375|Caenorhabditis elegans Hypothetical
           protein T25C8.2 protein.
          Length = 375

 Score =  181 bits (441), Expect = 5e-46
 Identities = 82/85 (96%), Positives = 84/85 (98%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 434
           AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELR+APEEHPVLLTEAPLNPK+NRE
Sbjct: 58  AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRIAPEEHPVLLTEAPLNPKSNRE 117

Query: 435 KMTQIMFETFNTPAMYVAIQAVLSL 509
           KMTQIMFETFNTPAMYV IQAVLSL
Sbjct: 118 KMTQIMFETFNTPAMYVNIQAVLSL 142



 Score =  124 bits (298), Expect = 1e-28
 Identities = 60/78 (76%), Positives = 65/78 (83%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YASGRTTGIVLD+GDGV+HTVPIYEGYALPHAI RLD +   LTDY+MKILTERGY+F T
Sbjct: 143 YASGRTTGIVLDTGDGVTHTVPIYEGYALPHAIQRLDLAGRDLTDYMMKILTERGYTFTT 202

Query: 689 NAXREIRS*TFKEKLCYV 742
            A REI     KEKLCYV
Sbjct: 203 TAEREIVR-DIKEKLCYV 219



 Score =  122 bits (294), Expect = 3e-28
 Identities = 55/60 (91%), Positives = 59/60 (98%)
 Frame = +1

Query: 88  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEHRAK 267
           +EE+AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE ++K
Sbjct: 2   EEEIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61


>J01044-1|AAA27889.1|   86|Caenorhabditis elegans protein (
           C.elegans (nematode)actin gene III, 5' end. ).
          Length = 86

 Score =  128 bits (310), Expect = 4e-30
 Identities = 58/62 (93%), Positives = 61/62 (98%)
 Frame = +1

Query: 82  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEHR 261
           MCD+EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE +
Sbjct: 1   MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 262 AK 267
           +K
Sbjct: 61  SK 62



 Score = 64.1 bits (149), Expect = 1e-10
 Identities = 28/28 (100%), Positives = 28/28 (100%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKI 338
           AQSKRGILTLKYPIEHGIVTNWDDMEKI
Sbjct: 59  AQSKRGILTLKYPIEHGIVTNWDDMEKI 86


>J01042-1|AAA27887.1|   86|Caenorhabditis elegans protein (
           C.elegans (nematode)actin gene I, 5' end. ).
          Length = 86

 Score =  128 bits (310), Expect = 4e-30
 Identities = 58/62 (93%), Positives = 61/62 (98%)
 Frame = +1

Query: 82  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEHR 261
           MCD+EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE +
Sbjct: 1   MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 262 AK 267
           +K
Sbjct: 61  SK 62



 Score = 64.1 bits (149), Expect = 1e-10
 Identities = 28/28 (100%), Positives = 28/28 (100%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKI 338
           AQSKRGILTLKYPIEHGIVTNWDDMEKI
Sbjct: 59  AQSKRGILTLKYPIEHGIVTNWDDMEKI 86


>J01046-1|AAA27890.1|   86|Caenorhabditis elegans protein (
           C.elegans (nematode)actin gene IV, 5' end. ).
          Length = 86

 Score =  127 bits (307), Expect = 9e-30
 Identities = 57/62 (91%), Positives = 61/62 (98%)
 Frame = +1

Query: 82  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEHR 261
           MCD++VAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE +
Sbjct: 1   MCDDDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 262 AK 267
           +K
Sbjct: 61  SK 62



 Score = 64.1 bits (149), Expect = 1e-10
 Identities = 28/28 (100%), Positives = 28/28 (100%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKI 338
           AQSKRGILTLKYPIEHGIVTNWDDMEKI
Sbjct: 59  AQSKRGILTLKYPIEHGIVTNWDDMEKI 86


>J01043-1|AAA27888.1|   83|Caenorhabditis elegans protein (
           C.elegans (nematode)actin gene II, 5' end. ).
          Length = 83

 Score =  127 bits (307), Expect = 9e-30
 Identities = 57/62 (91%), Positives = 61/62 (98%)
 Frame = +1

Query: 82  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEHR 261
           MCD++VAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE +
Sbjct: 1   MCDDDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 262 AK 267
           +K
Sbjct: 61  SK 62



 Score = 58.4 bits (135), Expect = 6e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDM 329
           AQSKRGILTLKYPIEHGIVTNWDDM
Sbjct: 59  AQSKRGILTLKYPIEHGIVTNWDDM 83


>AL132949-19|CAB70110.2|  374|Caenorhabditis elegans Hypothetical
           protein Y53F4B.22 protein.
          Length = 374

 Score =  125 bits (302), Expect = 4e-29
 Identities = 53/86 (61%), Positives = 70/86 (81%), Gaps = 1/86 (1%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTF-YNELRVAPEEHPVLLTEAPLNPKANR 431
           A+S RG+ +++YP+EHGIV NW DMEKIW + F  ++L++ PEEHPVLLT+APLNP  NR
Sbjct: 61  AESNRGLFSIEYPMEHGIVNNWSDMEKIWEYIFGQDQLKIFPEEHPVLLTDAPLNPLKNR 120

Query: 432 EKMTQIMFETFNTPAMYVAIQAVLSL 509
           E+  +I FETFN PA+Y+ +QAVLSL
Sbjct: 121 ERSAEIFFETFNVPALYIQMQAVLSL 146



 Score = 81.8 bits (193), Expect = 6e-16
 Identities = 39/78 (50%), Positives = 52/78 (66%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YA+GRTTG+VLDSGDGV+H VPI +G+A+ HAI R+D +   +T+YL  +L   GY F  
Sbjct: 147 YATGRTTGVVLDSGDGVTHAVPIVKGFAMKHAIQRMDLAGRDVTEYLRVLLRREGYEFHR 206

Query: 689 NAXREIRS*TFKEKLCYV 742
           +   EI     KE  CY+
Sbjct: 207 SNEFEIVR-EMKENACYL 223



 Score = 54.8 bits (126), Expect = 7e-08
 Identities = 23/48 (47%), Positives = 33/48 (68%)
 Frame = +1

Query: 106 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVG 249
           +V+DNGSG+ KAGFAG+  P+  F + VGRP++  VM G    D ++G
Sbjct: 11  VVIDNGSGVIKAGFAGEQQPKVRFANFVGRPKYHRVMAGGLDGDIFIG 58


>AC024200-9|AAF36012.1|  425|Caenorhabditis elegans Arp2/3 complex
           component protein 1 protein.
          Length = 425

 Score =  101 bits (243), Expect = 5e-22
 Identities = 44/78 (56%), Positives = 55/78 (70%)
 Frame = +3

Query: 279 TLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFE 458
           T+KYPI HGIV +WD ME+ W    +  LR  PE+H  LLTE PLN   NRE   +IMFE
Sbjct: 80  TVKYPIRHGIVEDWDLMERYWEQCIFKYLRAEPEDHFFLLTEPPLNTPENREYTAEIMFE 139

Query: 459 TFNTPAMYVAIQAVLSLT 512
           +FN P +Y+A+QAVL+LT
Sbjct: 140 SFNVPGLYIAVQAVLALT 157



 Score = 56.0 bits (129), Expect = 3e-08
 Identities = 25/81 (30%), Positives = 45/81 (55%)
 Frame = +2

Query: 527 TGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFITNAXREI 706
           TG+V+DSGDGV+H +P+ +GY +   I  +  +   +T ++  +L +R ++       E+
Sbjct: 171 TGLVIDSGDGVTHCIPVADGYVIGSCIKHIPIAGRDITYFIQSLLRDREHTIPAEQSYEV 230

Query: 707 RS*TFKEKLCYVGS*LSKQXI 769
                KEK CYV   + K+ +
Sbjct: 231 AK-MIKEKFCYVCPDVMKEFV 250



 Score = 36.7 bits (81), Expect = 0.021
 Identities = 14/36 (38%), Positives = 23/36 (63%)
 Frame = +1

Query: 82  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIV 189
           M   ++ A V+DNG+G  K G+AG+  P+ + PS +
Sbjct: 1   MSAHQLPACVIDNGTGYTKLGYAGNTEPQFIIPSAI 36


>Z71181-1|CAA94894.1|  395|Caenorhabditis elegans Hypothetical
           protein K07C5.1 protein.
          Length = 395

 Score = 99.5 bits (237), Expect = 3e-21
 Identities = 48/101 (47%), Positives = 66/101 (65%), Gaps = 1/101 (0%)
 Frame = +3

Query: 210 RDGRYGTEGLLCRR*AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNE-LRVAPEEH 386
           R G    + L+        R +L + YP+++GIV NWDDM  +W HTF  E L + P+E 
Sbjct: 46  RVGNIEIKDLMVGEECSQLRQMLDINYPMDNGIVRNWDDMAHVWDHTFGPEKLDIDPKEC 105

Query: 387 PVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 509
            +LLTE PLNP +NREKM Q+MFE +   ++YVA+QAVL+L
Sbjct: 106 KLLLTEPPLNPNSNREKMFQVMFEQYGFNSIYVAVQAVLTL 146



 Score = 85.4 bits (202), Expect = 5e-17
 Identities = 41/79 (51%), Positives = 55/79 (69%), Gaps = 1/79 (1%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YA G  TG+V+DSGDGV+H  P+YEG+AL H   RLD +   +T YL+K+L +RGY+F  
Sbjct: 147 YAQGLLTGVVVDSGDGVTHICPVYEGFALHHLTRRLDIAGRDITKYLIKLLLQRGYNFNH 206

Query: 689 NAXRE-IRS*TFKEKLCYV 742
           +A  E +R    KEKLCY+
Sbjct: 207 SADFETVRQ--MKEKLCYI 223



 Score = 47.2 bits (107), Expect = 1e-05
 Identities = 24/52 (46%), Positives = 33/52 (63%), Gaps = 2/52 (3%)
 Frame = +1

Query: 106 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP--RHQGVMVGMGQKDSYVGDE 255
           +VVDNG+G  K G+AG + P  +FPS+VGRP  R    +  +  KD  VG+E
Sbjct: 9   IVVDNGTGFVKCGYAGTNFPAHIFPSMVGRPIVRSTQRVGNIEIKDLMVGEE 60


>AC006833-3|AAF60947.2|  436|Caenorhabditis elegans Hypothetical
           protein ZK616.4 protein.
          Length = 436

 Score = 72.9 bits (171), Expect = 3e-13
 Identities = 32/71 (45%), Positives = 47/71 (66%)
 Frame = +3

Query: 294 IEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTP 473
           ++ G++ +W+  EKI  H++ N L   P EHPVL +E+  N +A REK+T+IMFE F  P
Sbjct: 94  MKEGLIEDWELFEKIVEHSYENILYSNPSEHPVLFSESSWNDRARREKLTEIMFEKFQVP 153

Query: 474 AMYVAIQAVLS 506
           A Y++   VLS
Sbjct: 154 AYYLSKNVVLS 164



 Score = 47.6 bits (108), Expect = 1e-05
 Identities = 18/54 (33%), Positives = 36/54 (66%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTER 670
           +A GRT G+++DSG   +  VP+++GYA+ HA+++       +T+ L ++L ++
Sbjct: 166 FAQGRTHGLMVDSGATQTSVVPVFDGYAVTHAVVKCPIGGDLITEQLAQMLDQQ 219



 Score = 33.5 bits (73), Expect = 0.20
 Identities = 14/33 (42%), Positives = 21/33 (63%)
 Frame = +1

Query: 91  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIV 189
           +EV+ LV D GS   + GFAG++ P+   PS +
Sbjct: 9   DEVSGLVFDAGSQSFRVGFAGEEYPKGDIPSYI 41


>U40799-8|AAA81487.1|  552|Caenorhabditis elegans Hypothetical
           protein F42C5.9 protein.
          Length = 552

 Score = 38.7 bits (86), Expect = 0.005
 Identities = 22/62 (35%), Positives = 35/62 (56%)
 Frame = +2

Query: 479 VRRHPSRALAYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKI 658
           + R PS  L YA   TTG+V+D G+ V+  VP+ +GY +  AI  + +   ++ D L   
Sbjct: 307 ITRQPSLIL-YAYDVTTGVVVDIGERVN-IVPVIDGYVVESAICSIPYGSQQMGDSLRAS 364

Query: 659 LT 664
           L+
Sbjct: 365 LS 366


>Z46676-5|CAA86667.3|  418|Caenorhabditis elegans Hypothetical
           protein C08B11.6 protein.
          Length = 418

 Score = 37.1 bits (82), Expect = 0.016
 Identities = 19/58 (32%), Positives = 29/58 (50%)
 Frame = +3

Query: 291 PIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETF 464
           PIE G V NWD  ++IW  TF   + V      + LT+      A  +  ++I+F+ F
Sbjct: 62  PIERGYVVNWDTQQQIWEKTF-GSMDVEASTSRIALTDNNYLIPALPDVSSEILFDYF 118


>U24189-2|AAC47513.1|  418|Caenorhabditis elegans actin-related
           protein-like protein.
          Length = 418

 Score = 37.1 bits (82), Expect = 0.016
 Identities = 19/58 (32%), Positives = 29/58 (50%)
 Frame = +3

Query: 291 PIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETF 464
           PIE G V NWD  ++IW  TF   + V      + LT+      A  +  ++I+F+ F
Sbjct: 62  PIERGYVVNWDTQQQIWEKTF-GSMDVEASTSRIALTDNNYLIPALPDVSSEILFDYF 118


>Z70287-6|CAH04747.1|  443|Caenorhabditis elegans Hypothetical
           protein R09E10.9 protein.
          Length = 443

 Score = 33.5 bits (73), Expect = 0.20
 Identities = 21/53 (39%), Positives = 23/53 (43%), Gaps = 2/53 (3%)
 Frame = +3

Query: 459 TFNTPAMYVAIQAVLSLTRPVVPPVSCWT--PATVSPTPCPSTRDTHSPTPSC 611
           T  +P+  V      SL  P VPP    T  P TVS  P PS      PT SC
Sbjct: 351 TIPSPSKVVPNPPQKSLITPTVPPSMIQTVNPPTVSALPSPSVSPAPVPTTSC 403


>U51998-7|AAA96080.2|  769|Caenorhabditis elegans Hypothetical
           protein C12D12.1a protein.
          Length = 769

 Score = 32.7 bits (71), Expect = 0.34
 Identities = 31/112 (27%), Positives = 45/112 (40%), Gaps = 5/112 (4%)
 Frame = +3

Query: 375 PEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLTRPVVPPVSCWTPAT 554
           P   P  +  +P  P       T  +  T +T A    +      T P VPPV+  TP T
Sbjct: 629 PTSPPSTVGTSPTAPANLTTPTTAPVNPTSSTTAPTAPVNPTSPTTAPTVPPVTTTTPTT 688

Query: 555 VSPTPCPSTRDTHS--PTPSC-VWTLAGRDSQTTS*RFSPSA--ATRSLPTP 695
            + T   +T  T +   TP+  V T     + TT     P++  AT+   TP
Sbjct: 689 TTSTTTTTTTTTTTTQTTPTTPVVTTPSTITPTTRPVTQPASQPATQPATTP 740


>U51998-6|ABS83845.1|  825|Caenorhabditis elegans Hypothetical protein
            C12D12.1c protein.
          Length = 825

 Score = 32.7 bits (71), Expect = 0.34
 Identities = 31/112 (27%), Positives = 45/112 (40%), Gaps = 5/112 (4%)
 Frame = +3

Query: 375  PEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLTRPVVPPVSCWTPAT 554
            P   P  +  +P  P       T  +  T +T A    +      T P VPPV+  TP T
Sbjct: 685  PTSPPSTVGTSPTAPANLTTPTTAPVNPTSSTTAPTAPVNPTSPTTAPTVPPVTTTTPTT 744

Query: 555  VSPTPCPSTRDTHS--PTPSC-VWTLAGRDSQTTS*RFSPSA--ATRSLPTP 695
             + T   +T  T +   TP+  V T     + TT     P++  AT+   TP
Sbjct: 745  TTSTTTTTTTTTTTTQTTPTTPVVTTPSTITPTTRPVTQPASQPATQPATTP 796


>AC006797-1|AAF60743.1| 1079|Caenorhabditis elegans Hypothetical
           protein Y51B11A.1 protein.
          Length = 1079

 Score = 31.9 bits (69), Expect = 0.60
 Identities = 32/106 (30%), Positives = 44/106 (41%), Gaps = 8/106 (7%)
 Frame = +3

Query: 399 TEAPLNPKANREKMTQIMFETFNT--PAMYVAIQAVLSLTRPVV----PPVSCWTPATVS 560
           TEAP +     +  T    ET +T  P+   +     + T P      PP S  TP   +
Sbjct: 155 TEAPSSSTTPVQTTTTTAPETTSTEPPSSSTSPVQTTTTTAPETTSTEPPSSSTTPVQTT 214

Query: 561 PTPCPSTRDTHSPTPSC--VWTLAGRDSQTTS*RFSPSAATRSLPT 692
            T  P T  T  P+ S   V T      +TTS   SPS++T  + T
Sbjct: 215 TTTAPETTSTEPPSSSTTPVQTTTTTAPETTS-TESPSSSTTPVQT 259



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 22/63 (34%), Positives = 28/63 (44%), Gaps = 2/63 (3%)
 Frame = +3

Query: 510 TRPVVPPVSCWTPATVSPTPCPSTRDTHSPTPSC--VWTLAGRDSQTTS*RFSPSAATRS 683
           T    PP S  TP   + T  P T  T SP+ S   V T      +TTS    PS++T  
Sbjct: 221 TTSTEPPSSSTTPVQTTTTTAPETTSTESPSSSTTPVQTTTTTAPETTS-TEPPSSSTTP 279

Query: 684 LPT 692
           + T
Sbjct: 280 VQT 282



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 22/63 (34%), Positives = 28/63 (44%), Gaps = 2/63 (3%)
 Frame = +3

Query: 510 TRPVVPPVSCWTPATVSPTPCPSTRDTHSPTPSC--VWTLAGRDSQTTS*RFSPSAATRS 683
           T    PP S  TP   + T  P T  T SP+ S   V T      +TTS    PS++T  
Sbjct: 497 TTSTEPPSSSTTPVQTTTTTAPETTSTESPSSSTTPVQTTTTTAPETTS-TEPPSSSTTP 555

Query: 684 LPT 692
           + T
Sbjct: 556 VQT 558



 Score = 29.9 bits (64), Expect = 2.4
 Identities = 21/63 (33%), Positives = 28/63 (44%), Gaps = 2/63 (3%)
 Frame = +3

Query: 510 TRPVVPPVSCWTPATVSPTPCPSTRDTHSPTPSC--VWTLAGRDSQTTS*RFSPSAATRS 683
           T    PP S  TP   + T  P T  T +P+ S   V T      +TTS    PS++T  
Sbjct: 83  TTSTEPPSSSTTPVQTTTTTAPETTSTEAPSSSTTPVQTTTTTAPETTS-TEPPSSSTSP 141

Query: 684 LPT 692
           + T
Sbjct: 142 VQT 144



 Score = 29.1 bits (62), Expect = 4.2
 Identities = 21/63 (33%), Positives = 27/63 (42%), Gaps = 2/63 (3%)
 Frame = +3

Query: 510 TRPVVPPVSCWTPATVSPTPCPSTRDTHSPTPSC--VWTLAGRDSQTTS*RFSPSAATRS 683
           T    PP S  TP   + T  P T  T  P+ S   V T      +TTS    PS++T  
Sbjct: 428 TTSTEPPSSSTTPVQTTTTTAPETTSTEPPSSSTTPVQTTTTTAPETTS-TEPPSSSTTP 486

Query: 684 LPT 692
           + T
Sbjct: 487 VQT 489



 Score = 29.1 bits (62), Expect = 4.2
 Identities = 21/63 (33%), Positives = 27/63 (42%), Gaps = 2/63 (3%)
 Frame = +3

Query: 510 TRPVVPPVSCWTPATVSPTPCPSTRDTHSPTPSC--VWTLAGRDSQTTS*RFSPSAATRS 683
           T    PP S  TP   + T  P T  T  P+ S   V T      +TTS    PS++T  
Sbjct: 543 TTSTEPPSSSTTPVQTTTTTAPETTSTEPPSSSTTPVQTTTTTAPETTS-TEPPSSSTTP 601

Query: 684 LPT 692
           + T
Sbjct: 602 VQT 604



 Score = 29.1 bits (62), Expect = 4.2
 Identities = 21/63 (33%), Positives = 27/63 (42%), Gaps = 2/63 (3%)
 Frame = +3

Query: 510 TRPVVPPVSCWTPATVSPTPCPSTRDTHSPTPSC--VWTLAGRDSQTTS*RFSPSAATRS 683
           T    PP S  TP   + T  P T  T  P+ S   V T      +TTS    PS++T  
Sbjct: 589 TTSTEPPSSSTTPVQTTTTTAPETTSTEPPSSSTTPVQTTTTTAPETTS-TEPPSSSTTP 647

Query: 684 LPT 692
           + T
Sbjct: 648 VQT 650



 Score = 28.7 bits (61), Expect = 5.6
 Identities = 21/63 (33%), Positives = 27/63 (42%), Gaps = 2/63 (3%)
 Frame = +3

Query: 510 TRPVVPPVSCWTPATVSPTPCPSTRDTHSPTPSC--VWTLAGRDSQTTS*RFSPSAATRS 683
           T    PP S  TP   +    P T  T  P+ S   V T      +TTS   SPS++T  
Sbjct: 474 TTSTEPPSSSTTPVQTTTITAPETTSTEPPSSSTTPVQTTTTTAPETTS-TESPSSSTTP 532

Query: 684 LPT 692
           + T
Sbjct: 533 VQT 535



 Score = 28.7 bits (61), Expect = 5.6
 Identities = 30/106 (28%), Positives = 43/106 (40%), Gaps = 8/106 (7%)
 Frame = +3

Query: 399  TEAPLNPKANREKMTQIMFETFNT--PAMYVAIQAVLSLTRPVV----PPVSCWTPATVS 560
            TE P +     +  T    ET +T  P+   +     ++T P      PP S  TP   +
Sbjct: 776  TEPPSSSNTPVQTTTTTAPETTSTEPPSSSTSPVQTTTITAPETTSTEPPSSSNTPVQTT 835

Query: 561  PTPCPSTRDTHSPTPSC--VWTLAGRDSQTTS*RFSPSAATRSLPT 692
             T  P T  T  P+ S   V T      +TTS    PS++T  + T
Sbjct: 836  TTTAPETTSTEPPSSSTSPVQTTTTTAPETTS-TEPPSSSTTPVQT 880



 Score = 28.3 bits (60), Expect = 7.4
 Identities = 20/63 (31%), Positives = 28/63 (44%), Gaps = 2/63 (3%)
 Frame = +3

Query: 510 TRPVVPPVSCWTPATVSPTPCPSTRDTHSPTPSC--VWTLAGRDSQTTS*RFSPSAATRS 683
           T    PP S  +P   + T  P T  T +P+ S   V T      +TTS    PS++T  
Sbjct: 129 TTSTEPPSSSTSPVQTTTTTAPETTSTEAPSSSTTPVQTTTTTAPETTS-TEPPSSSTSP 187

Query: 684 LPT 692
           + T
Sbjct: 188 VQT 190



 Score = 28.3 bits (60), Expect = 7.4
 Identities = 21/63 (33%), Positives = 27/63 (42%), Gaps = 2/63 (3%)
 Frame = +3

Query: 510 TRPVVPPVSCWTPATVSPTPCPSTRDTHSPTPSC--VWTLAGRDSQTTS*RFSPSAATRS 683
           T    PP S  TP   + T  P T  T  P+ S   V T      +TTS    PS++T  
Sbjct: 267 TTSTEPPSSSTTPVQTTTTTAPETTSTEPPSSSTTPVQTTTITAPETTS-TEPPSSSTTP 325

Query: 684 LPT 692
           + T
Sbjct: 326 VQT 328



 Score = 28.3 bits (60), Expect = 7.4
 Identities = 21/63 (33%), Positives = 27/63 (42%), Gaps = 2/63 (3%)
 Frame = +3

Query: 510 TRPVVPPVSCWTPATVSPTPCPSTRDTHSPTPSC--VWTLAGRDSQTTS*RFSPSAATRS 683
           T    PP S  TP   + T  P T  T  P+ S   V T      +TTS    PS++T  
Sbjct: 382 TTSTEPPSSSTTPVQTTTTTAPETTSTEPPSSSTTPVQTTTITAPETTS-TEPPSSSTTP 440

Query: 684 LPT 692
           + T
Sbjct: 441 VQT 443



 Score = 28.3 bits (60), Expect = 7.4
 Identities = 21/63 (33%), Positives = 27/63 (42%), Gaps = 2/63 (3%)
 Frame = +3

Query: 510 TRPVVPPVSCWTPATVSPTPCPSTRDTHSPTPS--CVWTLAGRDSQTTS*RFSPSAATRS 683
           T    PP S  TP   + T  P T  T  P+ S   V T      +TTS    PS++T  
Sbjct: 658 TTSTEPPSSSTTPVQTTTTTAPETTSTEPPSSSNTPVQTTTTTAPETTS-TEPPSSSTSP 716

Query: 684 LPT 692
           + T
Sbjct: 717 VQT 719



 Score = 28.3 bits (60), Expect = 7.4
 Identities = 21/63 (33%), Positives = 27/63 (42%), Gaps = 2/63 (3%)
 Frame = +3

Query: 510 TRPVVPPVSCWTPATVSPTPCPSTRDTHSPTPS--CVWTLAGRDSQTTS*RFSPSAATRS 683
           T    PP S  TP   + T  P T  T  P+ S   V T      +TTS    PS++T  
Sbjct: 750 TTSTEPPSSSTTPVQTTTTTAPETTSTEPPSSSNTPVQTTTTTAPETTS-TEPPSSSTSP 808

Query: 684 LPT 692
           + T
Sbjct: 809 VQT 811



 Score = 28.3 bits (60), Expect = 7.4
 Identities = 21/63 (33%), Positives = 27/63 (42%), Gaps = 2/63 (3%)
 Frame = +3

Query: 510  TRPVVPPVSCWTPATVSPTPCPSTRDTHSPTPSC--VWTLAGRDSQTTS*RFSPSAATRS 683
            T    PP S  TP   + T  P T  T  P+ S   V T      +TTS    PS++T  
Sbjct: 888  TTSTEPPSSSTTPVQTTTTTAPETTSTEPPSSSTTPVQTTTITAPETTS-TEPPSSSTTP 946

Query: 684  LPT 692
            + T
Sbjct: 947  VQT 949


>Z49968-1|CAA90258.2|  499|Caenorhabditis elegans Hypothetical
           protein M110.1 protein.
          Length = 499

 Score = 31.5 bits (68), Expect = 0.79
 Identities = 16/29 (55%), Positives = 18/29 (62%)
 Frame = +3

Query: 186 RGKAPPSGRDGRYGTEGLLCRR*AQSKRG 272
           RGKA  +GRDGR G EG    R  Q +RG
Sbjct: 216 RGKAGHTGRDGRPGLEGTPGTRGVQGERG 244


>U64835-5|AAG24196.1|  592|Caenorhabditis elegans Hypothetical
           protein T09D3.3 protein.
          Length = 592

 Score = 31.5 bits (68), Expect = 0.79
 Identities = 23/76 (30%), Positives = 31/76 (40%)
 Frame = +3

Query: 420 KANREKMTQIMFETFNTPAMYVAIQAVLSLTRPVVPPVSCWTPATVSPTPCPSTRDTHSP 599
           K+ +E  T I F T  TP       +  +    +VP  S  T  T + TP P T  T  P
Sbjct: 428 KSTKEPKTTI-FTT--TPVPCPTTTSTTTSATTLVPTTSSSTTTTTTTTPVPVTSTTTEP 484

Query: 600 TPSCVWTLAGRDSQTT 647
           T +   T     + TT
Sbjct: 485 TTTTYTTSTSTSTTTT 500



 Score = 30.7 bits (66), Expect = 1.4
 Identities = 15/47 (31%), Positives = 24/47 (51%)
 Frame = +3

Query: 552 TVSPTPCPSTRDTHSPTPSCVWTLAGRDSQTTS*RFSPSAATRSLPT 692
           T +P PCP+T  T +   + V T +   + TT+    P  +T + PT
Sbjct: 439 TTTPVPCPTTTSTTTSATTLVPTTSSSTTTTTTTTPVPVTSTTTEPT 485


>Z81479-1|CAB03944.1| 1043|Caenorhabditis elegans Hypothetical
           protein C34F6.1 protein.
          Length = 1043

 Score = 31.1 bits (67), Expect = 1.0
 Identities = 22/76 (28%), Positives = 32/76 (42%), Gaps = 1/76 (1%)
 Frame = +3

Query: 471 PAMYVAIQAVLSLTRPVVPPVSCWTPATVSPTPCPSTRDTHS-PTPSCVWTLAGRDSQTT 647
           P + V I+ + S   P+ P V+   P    PTP PST    + P P+    +  +    T
Sbjct: 65  PNVQVQIRTIPSAPGPIRPVVNPAPPLPTLPTPPPSTLPPITYPRPTVGAPITTQQVLIT 124

Query: 648 S*RFSPSAATRSLPTP 695
                P   T +L TP
Sbjct: 125 ETTTQPPTTTTTLETP 140


>Z81044-5|CAE17706.2|  460|Caenorhabditis elegans Hypothetical
           protein C30H6.11 protein.
          Length = 460

 Score = 30.3 bits (65), Expect = 1.8
 Identities = 23/100 (23%), Positives = 33/100 (33%), Gaps = 2/100 (2%)
 Frame = +3

Query: 399 TEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLTRPVVPPVSCWTPATVSPTPCPS 578
           T     P       T    ET  TP            T    P  +  TP T + TP  +
Sbjct: 119 TPTTTTPTTTTTTPTTTTTETTTTPTTTTTETTTTPTTTTTTPTTTTTTPTTTTTTPTTT 178

Query: 579 TR--DTHSPTPSCVWTLAGRDSQTTS*RFSPSAATRSLPT 692
           T    T + TP+   T     + T +   +    T ++PT
Sbjct: 179 TTTPTTTTTTPTTTTTAPTTTTTTPTTTTTTPTTTTTVPT 218



 Score = 29.1 bits (62), Expect = 4.2
 Identities = 25/119 (21%), Positives = 41/119 (34%)
 Frame = +3

Query: 387 PVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLTRPVVPPVSCWTPATVSPT 566
           P   T AP          T     T   P          + T    P  +  TP T + T
Sbjct: 189 PTTTTTAPTTTTTTPTTTTTTPTTTTTVPTTTTTTPTTTTTTT-TTPTTTTTTPTTTT-T 246

Query: 567 PCPSTRDTHSPTPSCVWTLAGRDSQTTS*RFSPSAATRSLPTPXGKFVREHSRRSCATS 743
           P  +T +T + TP+       + + TT+   +P+    +  TP        + +S  T+
Sbjct: 247 PATTTSETTTTTPTTTTQTTTKPTTTTT---TPTTTPTTTTTPTTTTTTAKTTKSTTTT 302



 Score = 28.3 bits (60), Expect = 7.4
 Identities = 17/62 (27%), Positives = 25/62 (40%)
 Frame = +3

Query: 510 TRPVVPPVSCWTPATVSPTPCPSTRDTHSPTPSCVWTLAGRDSQTTS*RFSPSAATRSLP 689
           T    P  +  TP T + TP  +T  T +PT     T     + TT+     +  T +  
Sbjct: 83  TTTTTPTTTTTTPTTTTTTPTTTTETTTTPTTETT-TTPTTTTPTTTTTTPTTTTTETTT 141

Query: 690 TP 695
           TP
Sbjct: 142 TP 143


>U51998-5|AAL00856.2|  648|Caenorhabditis elegans Hypothetical
           protein C12D12.1b protein.
          Length = 648

 Score = 30.3 bits (65), Expect = 1.8
 Identities = 26/84 (30%), Positives = 37/84 (44%), Gaps = 5/84 (5%)
 Frame = +3

Query: 459 TFNTPAMYVAIQAVLSLTRPVVPPVSCWTPATVSPTPCPSTRDTHS--PTPSC-VWTLAG 629
           T +T A    +      T P VPPV+  TP T + T   +T  T +   TP+  V T   
Sbjct: 536 TSSTTAPTAPVNPTSPTTAPTVPPVTTTTPTTTTSTTTTTTTTTTTTQTTPTTPVVTTPS 595

Query: 630 RDSQTTS*RFSPSA--ATRSLPTP 695
             + TT     P++  AT+   TP
Sbjct: 596 TITPTTRPVTQPASQPATQPATTP 619



 Score = 29.5 bits (63), Expect = 3.2
 Identities = 19/67 (28%), Positives = 29/67 (43%), Gaps = 1/67 (1%)
 Frame = +3

Query: 495 AVLSLTRPVVPPVSCWTPATVSPTPCPSTRDTHSPT-PSCVWTLAGRDSQTTS*RFSPSA 671
           A  +LT P   PV+  +  T    P   T  T +PT P    T     + TT+   + + 
Sbjct: 521 APANLTTPTTAPVNPTSSTTAPTAPVNPTSPTTAPTVPPVTTTTPTTTTSTTTTTTTTTT 580

Query: 672 ATRSLPT 692
            T++ PT
Sbjct: 581 TTQTTPT 587


>Z68317-3|CAA92687.1|  599|Caenorhabditis elegans Hypothetical
           protein T01H3.3 protein.
          Length = 599

 Score = 29.9 bits (64), Expect = 2.4
 Identities = 13/30 (43%), Positives = 17/30 (56%)
 Frame = +3

Query: 516 PVVPPVSCWTPATVSPTPCPSTRDTHSPTP 605
           P++PP     PA V  T  P+TR+T  P P
Sbjct: 97  PILPPTE--KPAPVITTETPTTRETEKPVP 124


>U40797-12|AAN84858.1|  230|Caenorhabditis elegans Gex interacting
           protein protein9, isoform c protein.
          Length = 230

 Score = 29.5 bits (63), Expect = 3.2
 Identities = 14/40 (35%), Positives = 24/40 (60%)
 Frame = +2

Query: 554 GVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERG 673
           G+SH +  +   +L  A   L+FS SR+ + + K+LT +G
Sbjct: 89  GLSHYIAEHAHPSLQLACQELEFSMSRINNVVSKLLTSQG 128


>U40797-11|AAN84857.1|  313|Caenorhabditis elegans Gex interacting
           protein protein9, isoform b protein.
          Length = 313

 Score = 29.5 bits (63), Expect = 3.2
 Identities = 14/40 (35%), Positives = 24/40 (60%)
 Frame = +2

Query: 554 GVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERG 673
           G+SH +  +   +L  A   L+FS SR+ + + K+LT +G
Sbjct: 172 GLSHYIAEHAHPSLQLACQELEFSMSRINNVVSKLLTSQG 211


>U40797-10|AAK95871.1|  617|Caenorhabditis elegans Gex interacting
           protein protein9, isoform a protein.
          Length = 617

 Score = 29.5 bits (63), Expect = 3.2
 Identities = 14/40 (35%), Positives = 24/40 (60%)
 Frame = +2

Query: 554 GVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERG 673
           G+SH +  +   +L  A   L+FS SR+ + + K+LT +G
Sbjct: 476 GLSHYIAEHAHPSLQLACQELEFSMSRINNVVSKLLTSQG 515


>Z92815-4|CAB07294.2| 2175|Caenorhabditis elegans Hypothetical protein
            W01F3.3 protein.
          Length = 2175

 Score = 28.7 bits (61), Expect = 5.6
 Identities = 21/83 (25%), Positives = 32/83 (38%)
 Frame = +3

Query: 375  PEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLTRPVVPPVSCWTPAT 554
            P E P ++   P +P   +  + Q+   T   P    A  A  + T P+ P  +   P T
Sbjct: 1499 PAEIPRVVV--PQSPGTPQPVVPQVSIVTPQAPQPTAA--ATSASTGPIAPEPTTAAPTT 1554

Query: 555  VSPTPCPSTRDTHSPTPSCVWTL 623
               TP P +   H P      T+
Sbjct: 1555 TETTPLPPSLAPHPPAAHAAKTV 1577


>Z66561-7|CAB54206.2|  419|Caenorhabditis elegans Hypothetical
           protein F08G12.10 protein.
          Length = 419

 Score = 28.7 bits (61), Expect = 5.6
 Identities = 15/50 (30%), Positives = 25/50 (50%), Gaps = 6/50 (12%)
 Frame = +3

Query: 429 REKMTQIMFETFN------TPAMYVAIQAVLSLTRPVVPPVSCWTPATVS 560
           R++  Q+ F+T +      TP + VA+   +S  +    P+ CWTP   S
Sbjct: 17  RKQQGQLAFDTIDRVNAWFTPFVLVAMTLAISCKQYFGQPIKCWTPREFS 66


>U50197-2|AAA91255.2|  624|Caenorhabditis elegans Hypothetical
           protein F25E2.2 protein.
          Length = 624

 Score = 28.7 bits (61), Expect = 5.6
 Identities = 17/59 (28%), Positives = 27/59 (45%)
 Frame = +3

Query: 516 PVVPPVSCWTPATVSPTPCPSTRDTHSPTPSCVWTLAGRDSQTTS*RFSPSAATRSLPT 692
           P  P  +  T  T +P P  +T  T +P P    T   + + TT+     + +T S+PT
Sbjct: 414 PTTPLPTTTTTTTTTPKPTTTTTTTTTPAP----TTTQKPTTTTTTPAPTTTSTTSIPT 468


>AF304127-1|AAG50240.1|  419|Caenorhabditis elegans innexin protein.
          Length = 419

 Score = 28.7 bits (61), Expect = 5.6
 Identities = 15/50 (30%), Positives = 25/50 (50%), Gaps = 6/50 (12%)
 Frame = +3

Query: 429 REKMTQIMFETFN------TPAMYVAIQAVLSLTRPVVPPVSCWTPATVS 560
           R++  Q+ F+T +      TP + VA+   +S  +    P+ CWTP   S
Sbjct: 17  RKQQGQLAFDTIDRVNAWFTPFVLVAMTLAISCKQYFGQPIKCWTPREFS 66


>Z81138-5|CAB63320.3| 1278|Caenorhabditis elegans Hypothetical
           protein W05B2.2 protein.
          Length = 1278

 Score = 28.3 bits (60), Expect = 7.4
 Identities = 23/85 (27%), Positives = 38/85 (44%), Gaps = 10/85 (11%)
 Frame = +3

Query: 381 EHPVLL--TEAPLNPKANREKMTQIMFE-TFNTPAMY-------VAIQAVLSLTRPVVPP 530
           +HP+LL  T+ P+    N +    + F+ T+++  M        V I   L  +RP +  
Sbjct: 724 QHPMLLFSTQQPMTCTPNSQNSCPLGFQCTYSSIRMLYFCCRDIVRIDKCLQGSRPEIWQ 783

Query: 531 VSCWTPATVSPTPCPSTRDTHSPTP 605
            +    A      CPST   ++PTP
Sbjct: 784 STAEPRACSRDAQCPSTTSCYAPTP 808


>U41263-13|AAC24428.2| 1844|Caenorhabditis elegans Hypothetical
           protein T19D12.1 protein.
          Length = 1844

 Score = 28.3 bits (60), Expect = 7.4
 Identities = 25/79 (31%), Positives = 35/79 (44%), Gaps = 4/79 (5%)
 Frame = +3

Query: 468 TPAMYVAIQAVLSLTRPV---VPPVSCWTPATVSPTPCPSTRDTHSPTPSCVWTLAGRDS 638
           TP+  V      +  RP    +P     +  T S +P PST  T S  PS  +T     S
Sbjct: 329 TPSSSVIPTTTQTTQRPTSTGIPSTVSTSQGTSSTSPIPSTTQTSSSAPS-TYTSNFTPS 387

Query: 639 QTTS*RFSPSA-ATRSLPT 692
            TT+   S  A +T+ +PT
Sbjct: 388 PTTTLLTSTIAPSTQGVPT 406


>AF188477-1|AAF01458.1| 1418|Caenorhabditis elegans phospholipase C
            beta protein.
          Length = 1418

 Score = 28.3 bits (60), Expect = 7.4
 Identities = 19/45 (42%), Positives = 21/45 (46%), Gaps = 3/45 (6%)
 Frame = +2

Query: 365  ACRPRGTPSPAH*GSPQPQGQQREDDPDHVRNIQ---HARHVRRH 490
            AC   GT SPA  GSP PQ     D    + N Q    +  VRRH
Sbjct: 1230 ACNSDGTGSPATIGSPVPQDLVNNDRVRSLVNTQTGEWSAMVRRH 1274


>AF179426-1|AAF05701.1| 1431|Caenorhabditis elegans phospholipase C
            beta homolog EGL-8 protein.
          Length = 1431

 Score = 28.3 bits (60), Expect = 7.4
 Identities = 19/45 (42%), Positives = 21/45 (46%), Gaps = 3/45 (6%)
 Frame = +2

Query: 365  ACRPRGTPSPAH*GSPQPQGQQREDDPDHVRNIQ---HARHVRRH 490
            AC   GT SPA  GSP PQ     D    + N Q    +  VRRH
Sbjct: 1243 ACNSDGTGSPATIGSPVPQDLVNNDRVRSLVNTQTGEWSAMVRRH 1287


>AF068714-6|AAL77167.1| 1419|Caenorhabditis elegans Egg laying
            defective protein 8,isoform a protein.
          Length = 1419

 Score = 28.3 bits (60), Expect = 7.4
 Identities = 19/45 (42%), Positives = 21/45 (46%), Gaps = 3/45 (6%)
 Frame = +2

Query: 365  ACRPRGTPSPAH*GSPQPQGQQREDDPDHVRNIQ---HARHVRRH 490
            AC   GT SPA  GSP PQ     D    + N Q    +  VRRH
Sbjct: 1231 ACNSDGTGSPATIGSPVPQDLVNNDRVRSLVNTQTGEWSAMVRRH 1275


>AF068714-5|AAL77168.1| 1431|Caenorhabditis elegans Egg laying
            defective protein 8,isoform b protein.
          Length = 1431

 Score = 28.3 bits (60), Expect = 7.4
 Identities = 19/45 (42%), Positives = 21/45 (46%), Gaps = 3/45 (6%)
 Frame = +2

Query: 365  ACRPRGTPSPAH*GSPQPQGQQREDDPDHVRNIQ---HARHVRRH 490
            AC   GT SPA  GSP PQ     D    + N Q    +  VRRH
Sbjct: 1243 ACNSDGTGSPATIGSPVPQDLVNNDRVRSLVNTQTGEWSAMVRRH 1287


>Z82258-1|CAB05122.2|  906|Caenorhabditis elegans Hypothetical
           protein C27H2.2a protein.
          Length = 906

 Score = 27.9 bits (59), Expect = 9.7
 Identities = 17/49 (34%), Positives = 28/49 (57%), Gaps = 2/49 (4%)
 Frame = -1

Query: 343 CQIFSMSSQLVTIPC-SMGYLRVRIPLLLCAHLLHKSPSVP-YRPSRPD 203
           CQ+FS   QLVT+   SMG +++++ +     L  KS + P   P+ P+
Sbjct: 251 CQLFSSQPQLVTMNLNSMGTIKLQLVVTWLPLLASKSSTKPTIAPNPPE 299


>Z74473-5|CAI79195.1|  245|Caenorhabditis elegans Hypothetical
           protein F56H9.6 protein.
          Length = 245

 Score = 27.9 bits (59), Expect = 9.7
 Identities = 21/84 (25%), Positives = 32/84 (38%), Gaps = 4/84 (4%)
 Frame = +3

Query: 456 ETFNTPAMYVAIQAVLSLTRPV----VPPVSCWTPATVSPTPCPSTRDTHSPTPSCVWTL 623
           E   T  +    + V + T PV     P  +  T  T + TP  +T  T + T S   T 
Sbjct: 38  EATTTTEITTTTEEVTTTTEPVTTTTTPTTTSTTSTTTTTTPTTTTTTTPTTTTSTTSTT 97

Query: 624 AGRDSQTTS*RFSPSAATRSLPTP 695
                 TT+   + +  T +  TP
Sbjct: 98  TTTTPTTTTSTTTTTTTTTTTATP 121


>Z49909-12|CAA90114.2|  121|Caenorhabditis elegans Hypothetical
           protein C14A4.10 protein.
          Length = 121

 Score = 27.9 bits (59), Expect = 9.7
 Identities = 12/33 (36%), Positives = 17/33 (51%)
 Frame = +2

Query: 422 GQQREDDPDHVRNIQHARHVRRHPSRALAYASG 520
           G   EDD + V N +  +HV R   R++ Y  G
Sbjct: 9   GSDAEDDKEKVVNPEDKKHVLRRDLRSMVYGFG 41


>AF535160-1|AAN33048.1|  468|Caenorhabditis elegans UNC-34 protein.
          Length = 468

 Score = 27.9 bits (59), Expect = 9.7
 Identities = 21/65 (32%), Positives = 24/65 (36%), Gaps = 3/65 (4%)
 Frame = +3

Query: 516 PVVPPVSCWTPATVSPTPCPSTRDTHSPTPSCVWTLAGRDSQ---TTS*RFSPSAATRSL 686
           P +PPV    P    P P P+     S TPS    L  R  Q    TS     +AA    
Sbjct: 237 PPLPPVGAGAPPPPPPPPPPAQLMASSGTPSLAEQLKMRSQQGLKATSNGVKAAAAEPEK 296

Query: 687 PTPXG 701
           P   G
Sbjct: 297 PAAKG 301


>AF038608-17|AAC25822.2|  425|Caenorhabditis elegans Hypothetical
           protein C09G12.9 protein.
          Length = 425

 Score = 27.9 bits (59), Expect = 9.7
 Identities = 18/56 (32%), Positives = 25/56 (44%)
 Frame = +3

Query: 438 MTQIMFETFNTPAMYVAIQAVLSLTRPVVPPVSCWTPATVSPTPCPSTRDTHSPTP 605
           + Q+M   F       A  A  S T       S  + A+ +PTP PS++ T  PTP
Sbjct: 127 LLQVMAMVFQEKCPVFARSAANSATNASATNPSAGSSASSTPTPYPSSQPT-MPTP 181


>AF025453-5|AAY55851.1|  279|Caenorhabditis elegans Hypothetical
           protein C08F1.11 protein.
          Length = 279

 Score = 27.9 bits (59), Expect = 9.7
 Identities = 10/25 (40%), Positives = 15/25 (60%)
 Frame = +1

Query: 136 KAGFAGDDAPRAVFPSIVGRPRHQG 210
           KA + G D P+A F  I+G   ++G
Sbjct: 44  KASYLGHDTPQATFREIIGNKEYRG 68


>AC025722-6|AAO12398.1|  310|Caenorhabditis elegans Uncoordinated
           protein 34, isoform b protein.
          Length = 310

 Score = 27.9 bits (59), Expect = 9.7
 Identities = 21/65 (32%), Positives = 24/65 (36%), Gaps = 3/65 (4%)
 Frame = +3

Query: 516 PVVPPVSCWTPATVSPTPCPSTRDTHSPTPSCVWTLAGRDSQ---TTS*RFSPSAATRSL 686
           P +PPV    P    P P P+     S TPS    L  R  Q    TS     +AA    
Sbjct: 223 PPLPPVGAGAPPPPPPPPPPAQLMASSGTPSLAEQLKMRSQQGLKATSNGVKAAAAEPEK 282

Query: 687 PTPXG 701
           P   G
Sbjct: 283 PAAKG 287


>AC025722-5|AAO12397.1|  454|Caenorhabditis elegans Uncoordinated
           protein 34, isoform a protein.
          Length = 454

 Score = 27.9 bits (59), Expect = 9.7
 Identities = 21/65 (32%), Positives = 24/65 (36%), Gaps = 3/65 (4%)
 Frame = +3

Query: 516 PVVPPVSCWTPATVSPTPCPSTRDTHSPTPSCVWTLAGRDSQ---TTS*RFSPSAATRSL 686
           P +PPV    P    P P P+     S TPS    L  R  Q    TS     +AA    
Sbjct: 223 PPLPPVGAGAPPPPPPPPPPAQLMASSGTPSLAEQLKMRSQQGLKATSNGVKAAAAEPEK 282

Query: 687 PTPXG 701
           P   G
Sbjct: 283 PAAKG 287


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 20,527,836
Number of Sequences: 27780
Number of extensions: 487799
Number of successful extensions: 2215
Number of sequences better than 10.0: 53
Number of HSP's better than 10.0 without gapping: 1759
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2152
length of database: 12,740,198
effective HSP length: 81
effective length of database: 10,490,018
effective search space used: 2129473654
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -