SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30134.Seq
         (882 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U53153-6|AAT81184.1|  638|Caenorhabditis elegans Germinal center...    31   1.1  
U53153-5|AAK77641.1|  651|Caenorhabditis elegans Germinal center...    31   1.1  
U53153-4|AAK77642.2|  650|Caenorhabditis elegans Germinal center...    31   1.1  
U53153-3|AAC69038.1|  653|Caenorhabditis elegans Germinal center...    31   1.1  
AF068708-11|AAC17757.1|  136|Caenorhabditis elegans Hypothetical...    31   1.4  
U80445-7|AAB37798.1|  368|Caenorhabditis elegans Hypothetical pr...    29   4.4  
U80437-6|AAB37621.1|  368|Caenorhabditis elegans Hypothetical pr...    29   4.4  
Z72514-1|CAA96674.1|  428|Caenorhabditis elegans Hypothetical pr...    29   5.8  
Z49909-3|CAA90107.2|  603|Caenorhabditis elegans Hypothetical pr...    29   5.8  

>U53153-6|AAT81184.1|  638|Caenorhabditis elegans Germinal center
           kinase family protein1, isoform d protein.
          Length = 638

 Score = 31.1 bits (67), Expect = 1.1
 Identities = 16/56 (28%), Positives = 28/56 (50%)
 Frame = -3

Query: 424 RNTLLSRHETASSSHRVANVXPVPAASKAHTGPAGGATHRPAHSGGGTPSRTLART 257
           RN+ +      S  +  ++     +  ++HT  +GGAT     S  G+P+ +LART
Sbjct: 371 RNSSVGSSGYGSGGNSASSQYATSSLPQSHTASSGGATTITLGSPNGSPTSSLART 426


>U53153-5|AAK77641.1|  651|Caenorhabditis elegans Germinal center
           kinase family protein1, isoform b protein.
          Length = 651

 Score = 31.1 bits (67), Expect = 1.1
 Identities = 16/56 (28%), Positives = 28/56 (50%)
 Frame = -3

Query: 424 RNTLLSRHETASSSHRVANVXPVPAASKAHTGPAGGATHRPAHSGGGTPSRTLART 257
           RN+ +      S  +  ++     +  ++HT  +GGAT     S  G+P+ +LART
Sbjct: 384 RNSSVGSSGYGSGGNSASSQYATSSLPQSHTASSGGATTITLGSPNGSPTSSLART 439


>U53153-4|AAK77642.2|  650|Caenorhabditis elegans Germinal center
           kinase family protein1, isoform c protein.
          Length = 650

 Score = 31.1 bits (67), Expect = 1.1
 Identities = 16/56 (28%), Positives = 28/56 (50%)
 Frame = -3

Query: 424 RNTLLSRHETASSSHRVANVXPVPAASKAHTGPAGGATHRPAHSGGGTPSRTLART 257
           RN+ +      S  +  ++     +  ++HT  +GGAT     S  G+P+ +LART
Sbjct: 383 RNSSVGSSGYGSGGNSASSQYATSSLPQSHTASSGGATTITLGSPNGSPTSSLART 438


>U53153-3|AAC69038.1|  653|Caenorhabditis elegans Germinal center
           kinase family protein1, isoform a protein.
          Length = 653

 Score = 31.1 bits (67), Expect = 1.1
 Identities = 16/56 (28%), Positives = 28/56 (50%)
 Frame = -3

Query: 424 RNTLLSRHETASSSHRVANVXPVPAASKAHTGPAGGATHRPAHSGGGTPSRTLART 257
           RN+ +      S  +  ++     +  ++HT  +GGAT     S  G+P+ +LART
Sbjct: 386 RNSSVGSSGYGSGGNSASSQYATSSLPQSHTASSGGATTITLGSPNGSPTSSLART 441


>AF068708-11|AAC17757.1|  136|Caenorhabditis elegans Hypothetical
           protein C18G1.1 protein.
          Length = 136

 Score = 30.7 bits (66), Expect = 1.4
 Identities = 14/35 (40%), Positives = 23/35 (65%)
 Frame = -3

Query: 166 LSIQSLKLYKQKPFRLTFPTESKYRHHRTAYEIVL 62
           +S+  LK Y +KP R    TE++ +H+RT + I+L
Sbjct: 45  ISLFPLKDYSRKPGRGPQRTEAEMKHYRTVFYIIL 79


>U80445-7|AAB37798.1|  368|Caenorhabditis elegans Hypothetical
           protein C50F2.5 protein.
          Length = 368

 Score = 29.1 bits (62), Expect = 4.4
 Identities = 12/34 (35%), Positives = 22/34 (64%)
 Frame = -3

Query: 103 SKYRHHRTAYEIVLIRNTNVARLSNYQNARIVVF 2
           +KY    T  E+V+ +N++    SNY++ R++VF
Sbjct: 189 TKYELELTDSEVVIDKNSDDPNASNYKSHRLIVF 222


>U80437-6|AAB37621.1|  368|Caenorhabditis elegans Hypothetical
           protein C43E11.5 protein.
          Length = 368

 Score = 29.1 bits (62), Expect = 4.4
 Identities = 12/34 (35%), Positives = 22/34 (64%)
 Frame = -3

Query: 103 SKYRHHRTAYEIVLIRNTNVARLSNYQNARIVVF 2
           +KY    T  E+V+ +N++    SNY++ R++VF
Sbjct: 189 TKYELELTDSEVVIDKNSDDPNASNYKSHRLIVF 222


>Z72514-1|CAA96674.1|  428|Caenorhabditis elegans Hypothetical
           protein T10B10.1 protein.
          Length = 428

 Score = 28.7 bits (61), Expect = 5.8
 Identities = 19/72 (26%), Positives = 28/72 (38%)
 Frame = -3

Query: 448 SKLPNL*RRNTLLSRHETASSSHRVANVXPVPAASKAHTGPAGGATHRPAHSGGGTPSRT 269
           ++ P   R     +R   A++    A+  PV       +G    A   PAH     PS +
Sbjct: 312 TRAPPATRAPPATTRAPPATTRPAPASQPPVREPETPDSGYPSPAPQEPAHPSPSYPSPS 371

Query: 268 LARTSHPGLSYP 233
               S+P  SYP
Sbjct: 372 YPSPSYPSPSYP 383


>Z49909-3|CAA90107.2|  603|Caenorhabditis elegans Hypothetical
           protein C14A4.3 protein.
          Length = 603

 Score = 28.7 bits (61), Expect = 5.8
 Identities = 20/67 (29%), Positives = 33/67 (49%), Gaps = 7/67 (10%)
 Frame = +2

Query: 491 HFYGTYFVSPSNITIDHLH*LIGNVLNGKNLFVFYVILGINNFNQYIFA-------HVAS 649
           H++G   ++P NI + ++    G  L G+    FY+    NN+N  IFA        +A 
Sbjct: 267 HYFGKTVLAPLNIFLYNVVSGPGPSLYGEEPLSFYIKNLFNNWNIVIFAAPFGFPLSLAY 326

Query: 650 FVIIWMT 670
           F  +WM+
Sbjct: 327 FTKVWMS 333


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 20,192,166
Number of Sequences: 27780
Number of extensions: 429935
Number of successful extensions: 1184
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 1112
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1182
length of database: 12,740,198
effective HSP length: 81
effective length of database: 10,490,018
effective search space used: 2223883816
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -