SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30133.Seq
         (693 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z79757-6|CAB02127.1|  350|Caenorhabditis elegans Hypothetical pr...    29   4.2  
Z67882-2|CAA91799.1| 1318|Caenorhabditis elegans Hypothetical pr...    29   4.2  
U50311-1|AAA92307.1|  492|Caenorhabditis elegans Hypothetical pr...    29   4.2  
Z35603-1|CAA84673.1| 1017|Caenorhabditis elegans Hypothetical pr...    28   5.5  
X75564-1|CAA53244.1| 1017|Caenorhabditis elegans myosin IA protein.    28   5.5  
AL032631-15|CAA21579.1|  137|Caenorhabditis elegans Hypothetical...    27   9.6  

>Z79757-6|CAB02127.1|  350|Caenorhabditis elegans Hypothetical
           protein F55B12.6 protein.
          Length = 350

 Score = 28.7 bits (61), Expect = 4.2
 Identities = 17/36 (47%), Positives = 20/36 (55%)
 Frame = -2

Query: 413 VALLSIVFSYSYFCFNSILFRLNLLRRPHKYINYVY 306
           V  +S VFS    CFNSIL  L + + P K  NY Y
Sbjct: 11  VQWISFVFS---ICFNSILIFLIITQSPKKMGNYRY 43


>Z67882-2|CAA91799.1| 1318|Caenorhabditis elegans Hypothetical
           protein F22E10.1 protein.
          Length = 1318

 Score = 28.7 bits (61), Expect = 4.2
 Identities = 14/69 (20%), Positives = 29/69 (42%), Gaps = 1/69 (1%)
 Frame = -2

Query: 512 ICAKNLTRNIIVHRMTCDSVMXXXXXXXXXXXKVALLSIVFSY-SYFCFNSILFRLNLLR 336
           I A N+T ++++H  T D               + ++ ++ ++  Y CF     R+    
Sbjct: 112 IIAGNITNSLLIHNATSDDFYDSAMTNVWLFGGIGIIVLIVNFVQYMCFQYCCIRITSKM 171

Query: 335 RPHKYINYV 309
           + H YI  +
Sbjct: 172 KQH-YIQSI 179


>U50311-1|AAA92307.1|  492|Caenorhabditis elegans Hypothetical
           protein C25E10.5 protein.
          Length = 492

 Score = 28.7 bits (61), Expect = 4.2
 Identities = 14/43 (32%), Positives = 23/43 (53%)
 Frame = -1

Query: 612 ITPIFRITLFRCTYVYYFYTIRSGVFFXLYFTYYMCQEFNTKH 484
           +TPIF  T+F    V   + I+S VFF +   +++  +  T H
Sbjct: 448 VTPIFTTTMFTLLGVGPLWLIKSSVFFAIAAVWFLNLKKITTH 490


>Z35603-1|CAA84673.1| 1017|Caenorhabditis elegans Hypothetical
           protein T02C12.1 protein.
          Length = 1017

 Score = 28.3 bits (60), Expect = 5.5
 Identities = 11/25 (44%), Positives = 15/25 (60%)
 Frame = -3

Query: 682 RNKNIFLRLNCLQATAACSTLTRNN 608
           R KN+ LR NC+     C+  TRN+
Sbjct: 135 RVKNVLLRSNCILEAFGCAKTTRND 159


>X75564-1|CAA53244.1| 1017|Caenorhabditis elegans myosin IA protein.
          Length = 1017

 Score = 28.3 bits (60), Expect = 5.5
 Identities = 11/25 (44%), Positives = 15/25 (60%)
 Frame = -3

Query: 682 RNKNIFLRLNCLQATAACSTLTRNN 608
           R KN+ LR NC+     C+  TRN+
Sbjct: 135 RVKNVLLRSNCILEAFGCAKTTRND 159


>AL032631-15|CAA21579.1|  137|Caenorhabditis elegans Hypothetical
           protein Y106G6H.16 protein.
          Length = 137

 Score = 27.5 bits (58), Expect = 9.6
 Identities = 17/46 (36%), Positives = 24/46 (52%)
 Frame = -2

Query: 650 PSGNCSLLNFDAQ*PRYFELLYSAVLTFIIFTLLEVVFFXFYILRI 513
           P+ N  ++N     P     L   VL  IIFTLL ++ + FY LR+
Sbjct: 84  PTENKKIINTIKVQPNSSSCLRCTVL-IIIFTLLCLIAYHFYFLRL 128


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 12,320,089
Number of Sequences: 27780
Number of extensions: 222160
Number of successful extensions: 573
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 562
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 573
length of database: 12,740,198
effective HSP length: 79
effective length of database: 10,545,578
effective search space used: 1592382278
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -