SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30131.Seq
         (482 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z37983-1|CAA86061.1|  276|Caenorhabditis elegans Hypothetical pr...   125   1e-29
U58760-7|AAK31463.1|  188|Caenorhabditis elegans Hypothetical pr...    35   0.027
Z81579-4|CAE17915.1|  212|Caenorhabditis elegans Hypothetical pr...    35   0.036
Z81573-2|CAB04626.1|  294|Caenorhabditis elegans Hypothetical pr...    35   0.036
Z66499-4|CAA91301.1|  164|Caenorhabditis elegans Hypothetical pr...    35   0.036
U55854-7|AAK68158.1|  166|Caenorhabditis elegans Hypothetical pr...    35   0.036
U55854-6|AAK68161.1|  197|Caenorhabditis elegans Hypothetical pr...    35   0.036
Z93398-8|CAJ80823.1| 3424|Caenorhabditis elegans Hypothetical pr...    31   0.44 
Z93398-5|CAD90186.2| 3436|Caenorhabditis elegans Hypothetical pr...    31   0.44 
Z93398-3|CAH04742.1| 3322|Caenorhabditis elegans Hypothetical pr...    31   0.44 
Z93398-2|CAH04741.1| 3323|Caenorhabditis elegans Hypothetical pr...    31   0.44 
Z93398-1|CAH04740.1| 3405|Caenorhabditis elegans Hypothetical pr...    31   0.44 
Z92788-8|CAJ80815.1| 3424|Caenorhabditis elegans Hypothetical pr...    31   0.44 
Z92788-5|CAD90175.2| 3436|Caenorhabditis elegans Hypothetical pr...    31   0.44 
Z92788-3|CAH04710.1| 3322|Caenorhabditis elegans Hypothetical pr...    31   0.44 
Z92788-2|CAH04709.1| 3323|Caenorhabditis elegans Hypothetical pr...    31   0.44 
Z92788-1|CAH04708.1| 3405|Caenorhabditis elegans Hypothetical pr...    31   0.44 
AJ505904-1|CAD44515.1| 3436|Caenorhabditis elegans VAB-10A prote...    31   0.44 
AJ505903-1|CAD44514.1| 3436|Caenorhabditis elegans VAB-10A prote...    31   0.44 
AJ505815-1|CAD44323.1| 3436|Caenorhabditis elegans VAB-10A prote...    31   0.44 
AL031632-6|CAA21008.1|  338|Caenorhabditis elegans Hypothetical ...    29   2.3  
AF025452-1|AAB70944.1|  411|Caenorhabditis elegans C-type lectin...    27   5.4  

>Z37983-1|CAA86061.1|  276|Caenorhabditis elegans Hypothetical
           protein B0393.1 protein.
          Length = 276

 Score =  125 bits (302), Expect = 1e-29
 Identities = 57/84 (67%), Positives = 69/84 (82%)
 Frame = +3

Query: 3   KLVLAARAVVAIENPADVFVISSRXFGQRAVLKFAAHTGATPIAGRFTPGAFTNQIQAAF 182
           KL+LAARA+ A+ENPADV V+S+R + QRA+LKFAAHTGAT I GRF+PG  TNQIQ  F
Sbjct: 57  KLLLAARAIAAVENPADVVVVSARPYAQRALLKFAAHTGATAIFGRFSPGCLTNQIQKTF 116

Query: 183 REPRLLIVLDPAQXHQPITEASYV 254
           +EPRLL++ DP   HQ +TEASYV
Sbjct: 117 KEPRLLVISDPRIDHQAVTEASYV 140



 Score = 73.7 bits (173), Expect = 6e-14
 Identities = 33/78 (42%), Positives = 45/78 (57%), Gaps = 5/78 (6%)
 Frame = +2

Query: 257 IPVIAXCNTDSPLXFVDIAIPCNTKSSHSIGLMWWXXXXXXXXXXXXXPRDQXW-----D 421
           +PVI+  NT+SPL  +DI +PCN K   SIGLMWW              R   +     +
Sbjct: 142 VPVISFVNTESPLKLIDIGVPCNNKGERSIGLMWWMLAREILILRGKISRQTGFVLEGKE 201

Query: 422 VVVDLFFYRDPEESEKDE 475
           ++ DL+FYRDP E+EK+E
Sbjct: 202 IMPDLYFYRDPTETEKEE 219


>U58760-7|AAK31463.1|  188|Caenorhabditis elegans Hypothetical
           protein C27A2.5 protein.
          Length = 188

 Score = 35.1 bits (77), Expect = 0.027
 Identities = 16/42 (38%), Positives = 18/42 (42%), Gaps = 1/42 (2%)
 Frame = +2

Query: 14  GCSCCRSHREPR*CVRHLITXLRSACCTEVCRXHR-CYAYCG 136
           GC CC    +   C R   T  R+ CCT  C   R C   CG
Sbjct: 82  GCGCCCCRPKCCCCCRRCCTCCRTCCCTRCCTCCRPCCCGCG 123


>Z81579-4|CAE17915.1|  212|Caenorhabditis elegans Hypothetical
           protein R13H4.8 protein.
          Length = 212

 Score = 34.7 bits (76), Expect = 0.036
 Identities = 16/42 (38%), Positives = 17/42 (40%), Gaps = 1/42 (2%)
 Frame = +2

Query: 14  GCSCCRSHREPR*CVRHLITXLRSACCTEVCRXHR-CYAYCG 136
           GC CC        C R   T  R+ CCT  C   R C   CG
Sbjct: 83  GCGCCCCRPRCCCCCRRCCTCCRTCCCTRCCTCCRPCCCGCG 124


>Z81573-2|CAB04626.1|  294|Caenorhabditis elegans Hypothetical
           protein M02G9.3 protein.
          Length = 294

 Score = 34.7 bits (76), Expect = 0.036
 Identities = 21/73 (28%), Positives = 30/73 (41%)
 Frame = +2

Query: 11  SGCSCCRSHREPR*CVRHLITXLRSACCTEVCRXHRCYAYCGTFHTRCFY*PDPSCIP*T 190
           S  SCC S      C+   +   +S+C T +C+  +C   C    T       PSC    
Sbjct: 38  SSSSCCSSSSSNSYCIPVCMAQCQSSCTTPICQ-QQCSNQCNQQCTSITISSGPSCSSCQ 96

Query: 191 SSLDCIGPCTXPS 229
           S+  C   CT P+
Sbjct: 97  SA--CSSACTTPT 107


>Z66499-4|CAA91301.1|  164|Caenorhabditis elegans Hypothetical
           protein T01B7.8 protein.
          Length = 164

 Score = 34.7 bits (76), Expect = 0.036
 Identities = 16/42 (38%), Positives = 17/42 (40%), Gaps = 1/42 (2%)
 Frame = +2

Query: 14  GCSCCRSHREPR*CVRHLITXLRSACCTEVCRXHR-CYAYCG 136
           GC CC        C R   T  R+ CCT  C   R C   CG
Sbjct: 81  GCGCCCCRPRCCCCCRRCCTCCRTCCCTRCCTCCRPCCCGCG 122


>U55854-7|AAK68158.1|  166|Caenorhabditis elegans Hypothetical
           protein C04G6.10 protein.
          Length = 166

 Score = 34.7 bits (76), Expect = 0.036
 Identities = 16/42 (38%), Positives = 17/42 (40%), Gaps = 1/42 (2%)
 Frame = +2

Query: 14  GCSCCRSHREPR*CVRHLITXLRSACCTEVCRXHR-CYAYCG 136
           GC CC        C R   T  R+ CCT  C   R C   CG
Sbjct: 82  GCGCCCCRPRCCCCCRRCCTCCRTCCCTRCCTCCRPCCCGCG 123


>U55854-6|AAK68161.1|  197|Caenorhabditis elegans Hypothetical
           protein C04G6.7 protein.
          Length = 197

 Score = 34.7 bits (76), Expect = 0.036
 Identities = 16/42 (38%), Positives = 17/42 (40%), Gaps = 1/42 (2%)
 Frame = +2

Query: 14  GCSCCRSHREPR*CVRHLITXLRSACCTEVCRXHR-CYAYCG 136
           GC CC        C R   T  R+ CCT  C   R C   CG
Sbjct: 83  GCGCCCCRPRCCCCCRRCCTCCRTCCCTRCCTCCRPCCCGCG 124


>Z93398-8|CAJ80823.1| 3424|Caenorhabditis elegans Hypothetical protein
            ZK1151.1h protein.
          Length = 3424

 Score = 31.1 bits (67), Expect = 0.44
 Identities = 16/54 (29%), Positives = 25/54 (46%)
 Frame = +3

Query: 81   GQRAVLKFAAHTGATPIAGRFTPGAFTNQIQAAFREPRLLIVLDPAQXHQPITE 242
            G    L+ A H       G+F  GA   +I  A +  RL ++  P++  Q +TE
Sbjct: 3127 GDLLTLRDALHQNKIDSNGKFVEGANRLKISDAVKSGRLTVIASPSEAVQAVTE 3180


>Z93398-5|CAD90186.2| 3436|Caenorhabditis elegans Hypothetical protein
            ZK1151.1a protein.
          Length = 3436

 Score = 31.1 bits (67), Expect = 0.44
 Identities = 16/54 (29%), Positives = 25/54 (46%)
 Frame = +3

Query: 81   GQRAVLKFAAHTGATPIAGRFTPGAFTNQIQAAFREPRLLIVLDPAQXHQPITE 242
            G    L+ A H       G+F  GA   +I  A +  RL ++  P++  Q +TE
Sbjct: 3139 GDLLTLRDALHQNKIDSNGKFVEGANRLKISDAVKSGRLTVIASPSEAVQAVTE 3192


>Z93398-3|CAH04742.1| 3322|Caenorhabditis elegans Hypothetical protein
            ZK1151.1f protein.
          Length = 3322

 Score = 31.1 bits (67), Expect = 0.44
 Identities = 16/54 (29%), Positives = 25/54 (46%)
 Frame = +3

Query: 81   GQRAVLKFAAHTGATPIAGRFTPGAFTNQIQAAFREPRLLIVLDPAQXHQPITE 242
            G    L+ A H       G+F  GA   +I  A +  RL ++  P++  Q +TE
Sbjct: 3025 GDLLTLRDALHQNKIDSNGKFVEGANRLKISDAVKSGRLTVIASPSEAVQAVTE 3078


>Z93398-2|CAH04741.1| 3323|Caenorhabditis elegans Hypothetical protein
            ZK1151.1e protein.
          Length = 3323

 Score = 31.1 bits (67), Expect = 0.44
 Identities = 16/54 (29%), Positives = 25/54 (46%)
 Frame = +3

Query: 81   GQRAVLKFAAHTGATPIAGRFTPGAFTNQIQAAFREPRLLIVLDPAQXHQPITE 242
            G    L+ A H       G+F  GA   +I  A +  RL ++  P++  Q +TE
Sbjct: 3026 GDLLTLRDALHQNKIDSNGKFVEGANRLKISDAVKSGRLTVIASPSEAVQAVTE 3079


>Z93398-1|CAH04740.1| 3405|Caenorhabditis elegans Hypothetical protein
            ZK1151.1d protein.
          Length = 3405

 Score = 31.1 bits (67), Expect = 0.44
 Identities = 16/54 (29%), Positives = 25/54 (46%)
 Frame = +3

Query: 81   GQRAVLKFAAHTGATPIAGRFTPGAFTNQIQAAFREPRLLIVLDPAQXHQPITE 242
            G    L+ A H       G+F  GA   +I  A +  RL ++  P++  Q +TE
Sbjct: 3108 GDLLTLRDALHQNKIDSNGKFVEGANRLKISDAVKSGRLTVIASPSEAVQAVTE 3161


>Z92788-8|CAJ80815.1| 3424|Caenorhabditis elegans Hypothetical protein
            ZK1151.1h protein.
          Length = 3424

 Score = 31.1 bits (67), Expect = 0.44
 Identities = 16/54 (29%), Positives = 25/54 (46%)
 Frame = +3

Query: 81   GQRAVLKFAAHTGATPIAGRFTPGAFTNQIQAAFREPRLLIVLDPAQXHQPITE 242
            G    L+ A H       G+F  GA   +I  A +  RL ++  P++  Q +TE
Sbjct: 3127 GDLLTLRDALHQNKIDSNGKFVEGANRLKISDAVKSGRLTVIASPSEAVQAVTE 3180


>Z92788-5|CAD90175.2| 3436|Caenorhabditis elegans Hypothetical protein
            ZK1151.1a protein.
          Length = 3436

 Score = 31.1 bits (67), Expect = 0.44
 Identities = 16/54 (29%), Positives = 25/54 (46%)
 Frame = +3

Query: 81   GQRAVLKFAAHTGATPIAGRFTPGAFTNQIQAAFREPRLLIVLDPAQXHQPITE 242
            G    L+ A H       G+F  GA   +I  A +  RL ++  P++  Q +TE
Sbjct: 3139 GDLLTLRDALHQNKIDSNGKFVEGANRLKISDAVKSGRLTVIASPSEAVQAVTE 3192


>Z92788-3|CAH04710.1| 3322|Caenorhabditis elegans Hypothetical protein
            ZK1151.1f protein.
          Length = 3322

 Score = 31.1 bits (67), Expect = 0.44
 Identities = 16/54 (29%), Positives = 25/54 (46%)
 Frame = +3

Query: 81   GQRAVLKFAAHTGATPIAGRFTPGAFTNQIQAAFREPRLLIVLDPAQXHQPITE 242
            G    L+ A H       G+F  GA   +I  A +  RL ++  P++  Q +TE
Sbjct: 3025 GDLLTLRDALHQNKIDSNGKFVEGANRLKISDAVKSGRLTVIASPSEAVQAVTE 3078


>Z92788-2|CAH04709.1| 3323|Caenorhabditis elegans Hypothetical protein
            ZK1151.1e protein.
          Length = 3323

 Score = 31.1 bits (67), Expect = 0.44
 Identities = 16/54 (29%), Positives = 25/54 (46%)
 Frame = +3

Query: 81   GQRAVLKFAAHTGATPIAGRFTPGAFTNQIQAAFREPRLLIVLDPAQXHQPITE 242
            G    L+ A H       G+F  GA   +I  A +  RL ++  P++  Q +TE
Sbjct: 3026 GDLLTLRDALHQNKIDSNGKFVEGANRLKISDAVKSGRLTVIASPSEAVQAVTE 3079


>Z92788-1|CAH04708.1| 3405|Caenorhabditis elegans Hypothetical protein
            ZK1151.1d protein.
          Length = 3405

 Score = 31.1 bits (67), Expect = 0.44
 Identities = 16/54 (29%), Positives = 25/54 (46%)
 Frame = +3

Query: 81   GQRAVLKFAAHTGATPIAGRFTPGAFTNQIQAAFREPRLLIVLDPAQXHQPITE 242
            G    L+ A H       G+F  GA   +I  A +  RL ++  P++  Q +TE
Sbjct: 3108 GDLLTLRDALHQNKIDSNGKFVEGANRLKISDAVKSGRLTVIASPSEAVQAVTE 3161


>AJ505904-1|CAD44515.1| 3436|Caenorhabditis elegans VAB-10A protein
            protein.
          Length = 3436

 Score = 31.1 bits (67), Expect = 0.44
 Identities = 16/54 (29%), Positives = 25/54 (46%)
 Frame = +3

Query: 81   GQRAVLKFAAHTGATPIAGRFTPGAFTNQIQAAFREPRLLIVLDPAQXHQPITE 242
            G    L+ A H       G+F  GA   +I  A +  RL ++  P++  Q +TE
Sbjct: 3139 GDLLTLRDALHQNKIDSNGKFVEGANRLKISDAVKSGRLTVIASPSEAVQAVTE 3192


>AJ505903-1|CAD44514.1| 3436|Caenorhabditis elegans VAB-10A protein
            protein.
          Length = 3436

 Score = 31.1 bits (67), Expect = 0.44
 Identities = 16/54 (29%), Positives = 25/54 (46%)
 Frame = +3

Query: 81   GQRAVLKFAAHTGATPIAGRFTPGAFTNQIQAAFREPRLLIVLDPAQXHQPITE 242
            G    L+ A H       G+F  GA   +I  A +  RL ++  P++  Q +TE
Sbjct: 3139 GDLLTLRDALHQNKIDSNGKFVEGANRLKISDAVKSGRLTVIASPSEAVQAVTE 3192


>AJ505815-1|CAD44323.1| 3436|Caenorhabditis elegans VAB-10A protein
            protein.
          Length = 3436

 Score = 31.1 bits (67), Expect = 0.44
 Identities = 16/54 (29%), Positives = 25/54 (46%)
 Frame = +3

Query: 81   GQRAVLKFAAHTGATPIAGRFTPGAFTNQIQAAFREPRLLIVLDPAQXHQPITE 242
            G    L+ A H       G+F  GA   +I  A +  RL ++  P++  Q +TE
Sbjct: 3139 GDLLTLRDALHQNKIDSNGKFVEGANRLKISDAVKSGRLTVIASPSEAVQAVTE 3192


>AL031632-6|CAA21008.1|  338|Caenorhabditis elegans Hypothetical
           protein Y32B12B.6 protein.
          Length = 338

 Score = 28.7 bits (61), Expect = 2.3
 Identities = 17/56 (30%), Positives = 27/56 (48%)
 Frame = +1

Query: 61  SSHHGPSVSVLY*SLPXTPVLRLLRDVSHQVLLLTRSKLHSVNLVS*LYWTLHXTI 228
           S+HH   V +L  S P    L++ + +  +   + R K H +N  S  Y TL  T+
Sbjct: 100 SAHHMNRVFLLLNSYPENSNLKIEQMLREETSFVARQKYHEMNWDSWYYITLVSTV 155


>AF025452-1|AAB70944.1|  411|Caenorhabditis elegans C-type lectin
           protein 2 protein.
          Length = 411

 Score = 27.5 bits (58), Expect = 5.4
 Identities = 15/40 (37%), Positives = 19/40 (47%)
 Frame = +2

Query: 236 Y*SFICXIPVIAXCNTDSPLXFVDIAIPCNTKSSHSIGLM 355
           Y SF+C  P    C+TD P   V   +P N    +S  LM
Sbjct: 269 YYSFVCKRPAGVPCSTDQPKVTV-TPVPSNESFCNSTVLM 307


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 10,767,150
Number of Sequences: 27780
Number of extensions: 209506
Number of successful extensions: 523
Number of sequences better than 10.0: 22
Number of HSP's better than 10.0 without gapping: 508
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 522
length of database: 12,740,198
effective HSP length: 76
effective length of database: 10,628,918
effective search space used: 892829112
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -