SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30125.Seq
         (682 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U41552-5|AAP82646.1|  183|Caenorhabditis elegans Vema (mammalian...    83   2e-16
U41552-4|AAD31555.1|  198|Caenorhabditis elegans Vema (mammalian...    83   2e-16
AL024499-6|CAA19709.1|  326|Caenorhabditis elegans Hypothetical ...    49   3e-06
AF016451-8|AAB66004.2|  354|Caenorhabditis elegans Serpentine re...    31   0.76 
AF016451-7|AAB66003.2|  312|Caenorhabditis elegans Serpentine re...    31   0.76 
Z75547-14|CAA99901.2|  461|Caenorhabditis elegans Hypothetical p...    28   7.1  
AF099921-1|AAC68807.1| 1286|Caenorhabditis elegans Hypothetical ...    28   7.1  

>U41552-5|AAP82646.1|  183|Caenorhabditis elegans Vema (mammalian
           ventral midlineantigen) related protein 1, isoform b
           protein.
          Length = 183

 Score = 83.0 bits (196), Expect = 2e-16
 Identities = 38/84 (45%), Positives = 50/84 (59%)
 Frame = +3

Query: 255 MTAVELRQYDGTQEGGRVLMAVNGWIFDVTRGNRFYGPGGPYAVFGGRDATRGLATFSVT 434
           MT  ELR+YDG +    +L  +NG I+DVTRG  FYGPG  Y    G DATR L T    
Sbjct: 50  MTVEELRKYDGVKNE-HILFGLNGTIYDVTRGKGFYGPGKAYGTLAGHDATRALGTMDQN 108

Query: 435 APEKDYDDLSDLNSMEMESVREWE 506
           A   ++DD + +++ E E+  EWE
Sbjct: 109 AVSSEWDDHTGISADEQETANEWE 132


>U41552-4|AAD31555.1|  198|Caenorhabditis elegans Vema (mammalian
           ventral midlineantigen) related protein 1, isoform a
           protein.
          Length = 198

 Score = 83.0 bits (196), Expect = 2e-16
 Identities = 38/84 (45%), Positives = 50/84 (59%)
 Frame = +3

Query: 255 MTAVELRQYDGTQEGGRVLMAVNGWIFDVTRGNRFYGPGGPYAVFGGRDATRGLATFSVT 434
           MT  ELR+YDG +    +L  +NG I+DVTRG  FYGPG  Y    G DATR L T    
Sbjct: 65  MTVEELRKYDGVKNE-HILFGLNGTIYDVTRGKGFYGPGKAYGTLAGHDATRALGTMDQN 123

Query: 435 APEKDYDDLSDLNSMEMESVREWE 506
           A   ++DD + +++ E E+  EWE
Sbjct: 124 AVSSEWDDHTGISADEQETANEWE 147


>AL024499-6|CAA19709.1|  326|Caenorhabditis elegans Hypothetical
           protein H38K22.3 protein.
          Length = 326

 Score = 49.2 bits (112), Expect = 3e-06
 Identities = 26/82 (31%), Positives = 41/82 (50%)
 Frame = +3

Query: 258 TAVELRQYDGTQEGGRVLMAVNGWIFDVTRGNRFYGPGGPYAVFGGRDATRGLATFSVTA 437
           T  +L  +DGT++   + +A+ G +++V     +YGPG  Y  F GRDATR   T     
Sbjct: 102 TPEQLHFFDGTRDSKPIYLAILGRVYNVDGKKEYYGPGKSYHHFAGRDATRAFTTGDFQE 161

Query: 438 PEKDYDDLSDLNSMEMESVREW 503
                     L+  E+ S+R+W
Sbjct: 162 SGL-IATTHGLSHDELLSIRDW 182


>AF016451-8|AAB66004.2|  354|Caenorhabditis elegans Serpentine
           receptor, class t protein65 protein.
          Length = 354

 Score = 31.1 bits (67), Expect = 0.76
 Identities = 13/41 (31%), Positives = 22/41 (53%)
 Frame = +1

Query: 79  NVQAKHSGFFETLKTLFCQPFIYFVFVSTFVILYKFYYKYK 201
           +++ K +G F  L+ + C P +   F S  +I+Y  Y K K
Sbjct: 208 DMEVKFAGLFAELELVLCFPTLALSFCSYILIIYSIYKKRK 248


>AF016451-7|AAB66003.2|  312|Caenorhabditis elegans Serpentine
           receptor, class t protein64 protein.
          Length = 312

 Score = 31.1 bits (67), Expect = 0.76
 Identities = 12/48 (25%), Positives = 26/48 (54%)
 Frame = +1

Query: 52  KMDSPPEVENVQAKHSGFFETLKTLFCQPFIYFVFVSTFVILYKFYYK 195
           ++  P    +++ K++  F +L+ + C P +   F+S  +I+Y  Y K
Sbjct: 157 ELTGPNWAYDMKVKYADLFASLELVLCFPTLALSFISYILIIYSIYKK 204


>Z75547-14|CAA99901.2|  461|Caenorhabditis elegans Hypothetical
           protein R11D1.7 protein.
          Length = 461

 Score = 27.9 bits (59), Expect = 7.1
 Identities = 13/41 (31%), Positives = 20/41 (48%)
 Frame = +1

Query: 70  EVENVQAKHSGFFETLKTLFCQPFIYFVFVSTFVILYKFYY 192
           EV  V    +  F   K   C P + FVF  TF+++Y  ++
Sbjct: 14  EVFTVLGALAASFLVEKRFLCAPRMIFVFQQTFMLIYIIFF 54


>AF099921-1|AAC68807.1| 1286|Caenorhabditis elegans Hypothetical
           protein M01E10.2 protein.
          Length = 1286

 Score = 27.9 bits (59), Expect = 7.1
 Identities = 19/46 (41%), Positives = 27/46 (58%), Gaps = 3/46 (6%)
 Frame = -1

Query: 415 SPLVASLPPKTAYGPPGP*NRF--PLVTSNIHPFT-AINTLPPSCV 287
           S +V +LP K +  P    + F  PLVTS+ +PFT  ++T P S V
Sbjct: 502 STVVHNLPTKPSSAPTLHPSTFSPPLVTSSENPFTFTLDTTPTSTV 547


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 16,331,543
Number of Sequences: 27780
Number of extensions: 357442
Number of successful extensions: 1245
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 1143
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1243
length of database: 12,740,198
effective HSP length: 79
effective length of database: 10,545,578
effective search space used: 1550199966
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -