SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30123.Seq
         (694 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z77131-2|CAB00853.4|  444|Caenorhabditis elegans Hypothetical pr...   153   2e-37
Z92803-10|CAB07246.1|  449|Caenorhabditis elegans Hypothetical p...   151   6e-37
Z35597-5|CAA84648.1|  450|Caenorhabditis elegans Hypothetical pr...   150   8e-37
Z46240-1|CAA86310.1|  444|Caenorhabditis elegans Hypothetical pr...   148   3e-36
X15242-1|CAA33320.1|  441|Caenorhabditis elegans beta-tubulin pr...   146   1e-35
U70844-1|AAB09092.1|  441|Caenorhabditis elegans Mechanosensory ...   146   1e-35
Z78200-11|CAB01587.2|  426|Caenorhabditis elegans Hypothetical p...    99   3e-21
Z78198-13|CAB01575.2|  426|Caenorhabditis elegans Hypothetical p...    99   3e-21
Z99709-10|CAB16856.1|  448|Caenorhabditis elegans Hypothetical p...    89   3e-18
D14965-1|BAA03610.1|  448|Caenorhabditis elegans alpha-2 tubulin...    89   3e-18
Z37140-7|CAA85497.2|  452|Caenorhabditis elegans Hypothetical pr...    88   6e-18
U65429-1|AAB48241.1|  450|Caenorhabditis elegans alpha-tubulin M...    87   9e-18
D21134-1|BAA22203.1|  449|Caenorhabditis elegans alpha-3 tubulin...    87   9e-18
AF003387-1|AAB54263.2|  450|Caenorhabditis elegans Mechanosensor...    87   9e-18
AB017190-1|BAA32600.1|  450|Caenorhabditis elegans Alpha tubulin...    87   9e-18
Z81070-8|CAB03001.1|  449|Caenorhabditis elegans Hypothetical pr...    87   1e-17
U40420-4|AAA81432.2|  456|Caenorhabditis elegans Tubulin, alpha ...    86   2e-17
D16439-1|BAA03909.1|  449|Caenorhabditis elegans alpha-1 tubulin...    86   2e-17
Z37092-12|CAA85463.1|  448|Caenorhabditis elegans Hypothetical p...    85   5e-17
AL023832-2|CAA19476.1|  448|Caenorhabditis elegans Hypothetical ...    85   5e-17
Z78062-1|CAB01495.1|  447|Caenorhabditis elegans Hypothetical pr...    85   6e-17
Z81134-1|CAB03447.1|  444|Caenorhabditis elegans Hypothetical pr...    84   8e-17
Z81523-9|CAB04246.2|  464|Caenorhabditis elegans Hypothetical pr...    79   3e-15
AB017191-1|BAA32601.1|  435|Caenorhabditis elegans alpha tubulin...    79   3e-15
Z22179-11|CAA80164.1|  444|Caenorhabditis elegans Hypothetical p...    60   1e-09
AF287259-1|AAG24513.1|  444|Caenorhabditis elegans gamma-tubulin...    60   1e-09
AF038606-7|AAB92021.1|  344|Caenorhabditis elegans Hypothetical ...    33   0.26 
Z72506-3|CAA96617.1|  310|Caenorhabditis elegans Hypothetical pr...    30   1.8  
U41992-5|AAA83356.1|  549|Caenorhabditis elegans Hypothetical pr...    30   1.8  
AF024496-2|AAB70340.1| 1459|Caenorhabditis elegans Hypothetical ...    29   2.4  
Z81579-9|CAN99688.1|  225|Caenorhabditis elegans Hypothetical pr...    29   3.2  
AL110485-3|CAB60351.1| 2145|Caenorhabditis elegans Hypothetical ...    28   5.5  
U42839-4|AAM54197.1|  114|Caenorhabditis elegans Hypothetical pr...    28   7.3  
U23525-10|AAC46571.2|  503|Caenorhabditis elegans Hypothetical p...    28   7.3  
U23525-9|ABC71820.1|  766|Caenorhabditis elegans Hypothetical pr...    28   7.3  
Z73098-2|CAA97331.2| 1058|Caenorhabditis elegans Hypothetical pr...    27   9.6  

>Z77131-2|CAB00853.4|  444|Caenorhabditis elegans Hypothetical
           protein C54C6.2 protein.
          Length = 444

 Score =  153 bits (370), Expect = 2e-37
 Identities = 76/145 (52%), Positives = 95/145 (65%)
 Frame = +3

Query: 255 QLERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWA 434
           QLERINVYYNEA+ GKYVPR VL+DL+P TMD+VRSGPFG LFRPDNFV+GQ+ A NNWA
Sbjct: 43  QLERINVYYNEANGGKYVPRAVLVDLEPGTMDSVRSGPFGQLFRPDNFVFGQSGAGNNWA 102

Query: 435 KGHYTEGVEILESALDVIRREAEGWIACKFSDVTLARWRYRFRIRYATS*TGYAKSIPTE 614
           KGHYTEG E++++ LDV+R+EAEG    +   +T +              +   +  P  
Sbjct: 103 KGHYTEGAELVDNVLDVVRKEAEGCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDR 162

Query: 615 LY*PFQSFQVPECRICVVEPYNTTL 689
           +   F     P+    VVEPYN TL
Sbjct: 163 IMSSFSVVPSPKVSDTVVEPYNATL 187



 Score = 76.2 bits (179), Expect = 2e-14
 Identities = 31/42 (73%), Positives = 35/42 (83%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDL 255
           MREI+++Q G CGNQIG KFWEVISDEHGI P G Y G+SDL
Sbjct: 1   MREIVHVQAGQCGNQIGAKFWEVISDEHGIQPDGTYKGESDL 42



 Score = 50.8 bits (116), Expect = 9e-07
 Identities = 24/52 (46%), Positives = 31/52 (59%)
 Frame = +2

Query: 503 GLDCLQVFRCHTRXXXXXXXXXXRYFVNRIREEYPDRIILTFSVFPSPRVSD 658
           G DCLQ F+                 +++IREEYPDRI+ +FSV PSP+VSD
Sbjct: 126 GCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMSSFSVVPSPKVSD 177


>Z92803-10|CAB07246.1|  449|Caenorhabditis elegans Hypothetical
           protein K01G5.7 protein.
          Length = 449

 Score =  151 bits (365), Expect = 6e-37
 Identities = 76/145 (52%), Positives = 95/145 (65%)
 Frame = +3

Query: 255 QLERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWA 434
           QLERI+VYYNEA+ GKYVPR VL+DL+P TMD+VRSGPFG LFRPDNFV+GQ+ A NNWA
Sbjct: 43  QLERIDVYYNEANNGKYVPRAVLVDLEPGTMDSVRSGPFGQLFRPDNFVFGQSGAGNNWA 102

Query: 435 KGHYTEGVEILESALDVIRREAEGWIACKFSDVTLARWRYRFRIRYATS*TGYAKSIPTE 614
           KGHYTEG E++++ LDVIR+EAEG    +   +T +              +   +  P  
Sbjct: 103 KGHYTEGAELVDNVLDVIRKEAEGCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEFPDR 162

Query: 615 LY*PFQSFQVPECRICVVEPYNTTL 689
           +   F     P+    VVEPYN TL
Sbjct: 163 IMSSFSVVPSPKVSDTVVEPYNATL 187



 Score = 74.5 bits (175), Expect = 6e-14
 Identities = 30/42 (71%), Positives = 35/42 (83%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDL 255
           MREI+++Q G CGNQIG KFWEVISDEHGI P G + G+SDL
Sbjct: 1   MREIVHVQAGQCGNQIGSKFWEVISDEHGIQPDGTFKGESDL 42



 Score = 49.2 bits (112), Expect = 3e-06
 Identities = 23/52 (44%), Positives = 31/52 (59%)
 Frame = +2

Query: 503 GLDCLQVFRCHTRXXXXXXXXXXRYFVNRIREEYPDRIILTFSVFPSPRVSD 658
           G DCLQ F+                 +++IREE+PDRI+ +FSV PSP+VSD
Sbjct: 126 GCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEFPDRIMSSFSVVPSPKVSD 177


>Z35597-5|CAA84648.1|  450|Caenorhabditis elegans Hypothetical
           protein C36E8.5 protein.
          Length = 450

 Score =  150 bits (364), Expect = 8e-37
 Identities = 76/145 (52%), Positives = 95/145 (65%)
 Frame = +3

Query: 255 QLERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWA 434
           QLERI+VYYNEA+ GKYVPR VL+DL+P TMD+VRSGPFG LFRPDNFV+GQ+ A NNWA
Sbjct: 43  QLERIDVYYNEANNGKYVPRAVLVDLEPGTMDSVRSGPFGQLFRPDNFVFGQSGAGNNWA 102

Query: 435 KGHYTEGVEILESALDVIRREAEGWIACKFSDVTLARWRYRFRIRYATS*TGYAKSIPTE 614
           KGHYTEG E++++ LDVIR+EAEG    +   +T +              +   +  P  
Sbjct: 103 KGHYTEGAELVDNVLDVIRKEAEGCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDR 162

Query: 615 LY*PFQSFQVPECRICVVEPYNTTL 689
           +   F     P+    VVEPYN TL
Sbjct: 163 IMSSFSVVPSPKVSDTVVEPYNATL 187



 Score = 73.3 bits (172), Expect = 1e-13
 Identities = 29/42 (69%), Positives = 35/42 (83%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDL 255
           MREI+++Q G CGNQIG KFWEVISDEHGI P G + G++DL
Sbjct: 1   MREIVHVQAGQCGNQIGSKFWEVISDEHGIQPDGTFKGETDL 42



 Score = 50.8 bits (116), Expect = 9e-07
 Identities = 24/52 (46%), Positives = 31/52 (59%)
 Frame = +2

Query: 503 GLDCLQVFRCHTRXXXXXXXXXXRYFVNRIREEYPDRIILTFSVFPSPRVSD 658
           G DCLQ F+                 +++IREEYPDRI+ +FSV PSP+VSD
Sbjct: 126 GCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMSSFSVVPSPKVSD 177


>Z46240-1|CAA86310.1|  444|Caenorhabditis elegans Hypothetical
           protein B0272.1 protein.
          Length = 444

 Score =  148 bits (359), Expect = 3e-36
 Identities = 74/145 (51%), Positives = 93/145 (64%)
 Frame = +3

Query: 255 QLERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWA 434
           QLERINVYYNEAS GKYVPR  L+DL+P TMD+VR+GPFG LFRPDNFV+GQ+ A NNWA
Sbjct: 43  QLERINVYYNEASGGKYVPRACLVDLEPGTMDSVRAGPFGQLFRPDNFVFGQSGAGNNWA 102

Query: 435 KGHYTEGVEILESALDVIRREAEGWIACKFSDVTLARWRYRFRIRYATS*TGYAKSIPTE 614
           KGHYTEG E++++ LDV+R+EAE     +   +T +              +   +  P  
Sbjct: 103 KGHYTEGAELVDNVLDVVRKEAESCDCLQGFQMTHSLGGGTGSGMGTLLISKIREEYPDR 162

Query: 615 LY*PFQSFQVPECRICVVEPYNTTL 689
           +   F     P+    VVEPYN TL
Sbjct: 163 IMMTFSVVPSPKVSDTVVEPYNATL 187



 Score = 82.2 bits (194), Expect = 3e-16
 Identities = 33/42 (78%), Positives = 38/42 (90%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDL 255
           MREI+++Q G CGNQIG KFWEVISDEHGIDP+G Y+GDSDL
Sbjct: 1   MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGAYNGDSDL 42



 Score = 52.0 bits (119), Expect = 4e-07
 Identities = 24/50 (48%), Positives = 31/50 (62%)
 Frame = +2

Query: 509 DCLQVFRCHTRXXXXXXXXXXRYFVNRIREEYPDRIILTFSVFPSPRVSD 658
           DCLQ F+                 +++IREEYPDRI++TFSV PSP+VSD
Sbjct: 128 DCLQGFQMTHSLGGGTGSGMGTLLISKIREEYPDRIMMTFSVVPSPKVSD 177


>X15242-1|CAA33320.1|  441|Caenorhabditis elegans beta-tubulin
           protein.
          Length = 441

 Score =  146 bits (355), Expect = 1e-35
 Identities = 73/145 (50%), Positives = 93/145 (64%)
 Frame = +3

Query: 255 QLERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWA 434
           QLERINVYYNEA + KYVPR VL+DL+P TMD+VRSGPFG LFRPDN+V+GQ+ A NNWA
Sbjct: 43  QLERINVYYNEAGSNKYVPRAVLVDLEPGTMDSVRSGPFGQLFRPDNYVFGQSGAGNNWA 102

Query: 435 KGHYTEGVEILESALDVIRREAEGWIACKFSDVTLARWRYRFRIRYATS*TGYAKSIPTE 614
           KGHYTEG E++++ LDV+R+EAE     +   +T +              +   +  P  
Sbjct: 103 KGHYTEGAELVDNVLDVVRKEAESTDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDR 162

Query: 615 LY*PFQSFQVPECRICVVEPYNTTL 689
           +   F     P+    VVEPYN TL
Sbjct: 163 IMNTFSVVPSPKVSDTVVEPYNATL 187



 Score = 80.6 bits (190), Expect = 1e-15
 Identities = 34/42 (80%), Positives = 37/42 (88%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDL 255
           MREI+++Q G CGNQIG KFWEVISDEHGIDPSG Y GDSDL
Sbjct: 1   MREIVHIQAGQCGNQIGSKFWEVISDEHGIDPSGQYVGDSDL 42



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 24/50 (48%), Positives = 30/50 (60%)
 Frame = +2

Query: 509 DCLQVFRCHTRXXXXXXXXXXRYFVNRIREEYPDRIILTFSVFPSPRVSD 658
           DCLQ F+                 +++IREEYPDRI+ TFSV PSP+VSD
Sbjct: 128 DCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSD 177


>U70844-1|AAB09092.1|  441|Caenorhabditis elegans Mechanosensory
           abnormality protein7 protein.
          Length = 441

 Score =  146 bits (355), Expect = 1e-35
 Identities = 73/145 (50%), Positives = 93/145 (64%)
 Frame = +3

Query: 255 QLERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWA 434
           QLERINVYYNEA + KYVPR VL+DL+P TMD+VRSGPFG LFRPDN+V+GQ+ A NNWA
Sbjct: 43  QLERINVYYNEAGSNKYVPRAVLVDLEPGTMDSVRSGPFGQLFRPDNYVFGQSGAGNNWA 102

Query: 435 KGHYTEGVEILESALDVIRREAEGWIACKFSDVTLARWRYRFRIRYATS*TGYAKSIPTE 614
           KGHYTEG E++++ LDV+R+EAE     +   +T +              +   +  P  
Sbjct: 103 KGHYTEGAELVDNVLDVVRKEAESTDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDR 162

Query: 615 LY*PFQSFQVPECRICVVEPYNTTL 689
           +   F     P+    VVEPYN TL
Sbjct: 163 IMNTFSVVPSPKVSDTVVEPYNATL 187



 Score = 80.6 bits (190), Expect = 1e-15
 Identities = 34/42 (80%), Positives = 37/42 (88%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDL 255
           MREI+++Q G CGNQIG KFWEVISDEHGIDPSG Y GDSDL
Sbjct: 1   MREIVHIQAGQCGNQIGSKFWEVISDEHGIDPSGQYVGDSDL 42



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 24/50 (48%), Positives = 30/50 (60%)
 Frame = +2

Query: 509 DCLQVFRCHTRXXXXXXXXXXRYFVNRIREEYPDRIILTFSVFPSPRVSD 658
           DCLQ F+                 +++IREEYPDRI+ TFSV PSP+VSD
Sbjct: 128 DCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSD 177


>Z78200-11|CAB01587.2|  426|Caenorhabditis elegans Hypothetical
           protein T04H1.9 protein.
          Length = 426

 Score = 99.1 bits (236), Expect = 3e-21
 Identities = 44/83 (53%), Positives = 59/83 (71%)
 Frame = +3

Query: 255 QLERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWA 434
           QLERI  YY E    KYVPR +L+DL P +++ VRS  +G LF P+N V G++ A NNW+
Sbjct: 43  QLERITSYYKEMEGRKYVPRAILVDLDPESINYVRSTQYGKLFDPENAVSGESGAGNNWS 102

Query: 435 KGHYTEGVEILESALDVIRREAE 503
           +G+Y +G EI++  L VIRREAE
Sbjct: 103 RGYYEQGAEIVDKVLSVIRREAE 125



 Score = 67.7 bits (158), Expect = 7e-12
 Identities = 27/40 (67%), Positives = 32/40 (80%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDS 249
           M+EIIN+QVG CGNQIG KFWE IS+EHG+   G Y GD+
Sbjct: 1   MKEIINVQVGQCGNQIGAKFWEYISEEHGLQTDGTYKGDN 40



 Score = 33.1 bits (72), Expect = 0.19
 Identities = 12/26 (46%), Positives = 20/26 (76%)
 Frame = +2

Query: 581 VNRIREEYPDRIILTFSVFPSPRVSD 658
           ++++REEY D+ + T S+ PS +VSD
Sbjct: 152 ISKLREEYSDKTLSTCSIIPSAKVSD 177


>Z78198-13|CAB01575.2|  426|Caenorhabditis elegans Hypothetical
           protein T04H1.9 protein.
          Length = 426

 Score = 99.1 bits (236), Expect = 3e-21
 Identities = 44/83 (53%), Positives = 59/83 (71%)
 Frame = +3

Query: 255 QLERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWA 434
           QLERI  YY E    KYVPR +L+DL P +++ VRS  +G LF P+N V G++ A NNW+
Sbjct: 43  QLERITSYYKEMEGRKYVPRAILVDLDPESINYVRSTQYGKLFDPENAVSGESGAGNNWS 102

Query: 435 KGHYTEGVEILESALDVIRREAE 503
           +G+Y +G EI++  L VIRREAE
Sbjct: 103 RGYYEQGAEIVDKVLSVIRREAE 125



 Score = 67.7 bits (158), Expect = 7e-12
 Identities = 27/40 (67%), Positives = 32/40 (80%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDS 249
           M+EIIN+QVG CGNQIG KFWE IS+EHG+   G Y GD+
Sbjct: 1   MKEIINVQVGQCGNQIGAKFWEYISEEHGLQTDGTYKGDN 40



 Score = 33.1 bits (72), Expect = 0.19
 Identities = 12/26 (46%), Positives = 20/26 (76%)
 Frame = +2

Query: 581 VNRIREEYPDRIILTFSVFPSPRVSD 658
           ++++REEY D+ + T S+ PS +VSD
Sbjct: 152 ISKLREEYSDKTLSTCSIIPSAKVSD 177


>Z99709-10|CAB16856.1|  448|Caenorhabditis elegans Hypothetical
           protein C47B2.3 protein.
          Length = 448

 Score = 89.0 bits (211), Expect = 3e-18
 Identities = 49/159 (30%), Positives = 84/159 (52%), Gaps = 7/159 (4%)
 Frame = +3

Query: 234 LPRRLRPQLERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQN 413
           +P +   + E    ++++  +G+YVPR++ +DL+P  +D +R+G +  LF P+  + G+ 
Sbjct: 36  MPTQSTNEGESFTTFFSDTGSGRYVPRSIFVDLEPTVVDEIRTGTYKKLFHPEQMITGKE 95

Query: 414 CAANNWAKGHYTEGVEILESALDVIRREAEG-------WIACKFSDVTLARWRYRFRIRY 572
            AANN+A+GHYT G E++++ LD IRR A+        ++   F   T + +      R 
Sbjct: 96  DAANNYARGHYTVGKELIDTVLDRIRRLADNCSGLQGFFVFHSFGGGTGSGFTSLLMERL 155

Query: 573 ATS*TGYAKSIPTELY*PFQSFQVPECRICVVEPYNTTL 689
           +     Y K    E    F  +  P+    VVEPYN+ L
Sbjct: 156 SVD---YGKKSKLE----FSIYPAPQVSTAVVEPYNSIL 187



 Score = 44.0 bits (99), Expect = 1e-04
 Identities = 22/51 (43%), Positives = 29/51 (56%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDLNSKGSTCTT 282
           MRE+I++ VG  G QIG   WE+   EHGI P G     S   ++G + TT
Sbjct: 1   MREVISIHVGQAGVQIGNACWELYCLEHGIQPDGTMPTQS--TNEGESFTT 49


>D14965-1|BAA03610.1|  448|Caenorhabditis elegans alpha-2 tubulin
           protein.
          Length = 448

 Score = 89.0 bits (211), Expect = 3e-18
 Identities = 49/159 (30%), Positives = 84/159 (52%), Gaps = 7/159 (4%)
 Frame = +3

Query: 234 LPRRLRPQLERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQN 413
           +P +   + E    ++++  +G+YVPR++ +DL+P  +D +R+G +  LF P+  + G+ 
Sbjct: 36  MPTQSTNEGESFTTFFSDTGSGRYVPRSIFVDLEPTVVDEIRTGTYKKLFHPEQMITGKE 95

Query: 414 CAANNWAKGHYTEGVEILESALDVIRREAEG-------WIACKFSDVTLARWRYRFRIRY 572
            AANN+A+GHYT G E++++ LD IRR A+        ++   F   T + +      R 
Sbjct: 96  DAANNYARGHYTVGKELIDTVLDRIRRLADNCSGLQGFFVFHSFGGGTGSGFTSLLMERL 155

Query: 573 ATS*TGYAKSIPTELY*PFQSFQVPECRICVVEPYNTTL 689
           +     Y K    E    F  +  P+    VVEPYN+ L
Sbjct: 156 SVD---YGKKSKLE----FSIYPAPQVSTAVVEPYNSIL 187



 Score = 44.0 bits (99), Expect = 1e-04
 Identities = 22/51 (43%), Positives = 29/51 (56%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDLNSKGSTCTT 282
           MRE+I++ VG  G QIG   WE+   EHGI P G     S   ++G + TT
Sbjct: 1   MREVISIHVGQAGVQIGNACWELYCLEHGIQPDGTMPTQS--TNEGESFTT 49


>Z37140-7|CAA85497.2|  452|Caenorhabditis elegans Hypothetical
           protein ZK899.4 protein.
          Length = 452

 Score = 87.8 bits (208), Expect = 6e-18
 Identities = 34/81 (41%), Positives = 57/81 (70%)
 Frame = +3

Query: 261 ERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWAKG 440
           + +  +++E+  GK+VPR + +DL+P  +D +R+G +G LF PD  + G+  AANN+A+G
Sbjct: 50  QSLQAFFSESMNGKHVPRAIYVDLEPTVLDEIRNGVYGNLFHPDQIINGKEDAANNYARG 109

Query: 441 HYTEGVEILESALDVIRREAE 503
           HYT G E+++  LD IR++ E
Sbjct: 110 HYTIGKELIDVVLDRIRKQTE 130



 Score = 38.3 bits (85), Expect = 0.005
 Identities = 14/33 (42%), Positives = 21/33 (63%)
 Frame = +1

Query: 133 REIINLQVGSCGNQIGGKFWEVISDEHGIDPSG 231
           RE +++ +G  G QIG   WE+   EHG+D +G
Sbjct: 6   RECVSIHIGQAGAQIGNACWELYCIEHGLDEAG 38


>U65429-1|AAB48241.1|  450|Caenorhabditis elegans alpha-tubulin
           MEC-12 protein.
          Length = 450

 Score = 87.4 bits (207), Expect = 9e-18
 Identities = 50/150 (33%), Positives = 81/150 (54%), Gaps = 7/150 (4%)
 Frame = +3

Query: 261 ERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWAKG 440
           +  + +++E  +G++VPR V++DL+P  +D +R+G +  LF P+  + G+  AANN+A+G
Sbjct: 47  DSFSTFFSETGSGRHVPRAVMVDLEPTVIDEIRTGTYRSLFHPEQLITGKEDAANNYARG 106

Query: 441 HYTEGVEILESALDVIRREA------EGWIAC-KFSDVTLARWRYRFRIRYATS*TGYAK 599
           HYT G EI++  LD IRR A      +G++    F   T + +      R +     Y K
Sbjct: 107 HYTIGKEIIDLTLDRIRRLADNCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVD---YGK 163

Query: 600 SIPTELY*PFQSFQVPECRICVVEPYNTTL 689
               E    F  +  P+    VVEPYN+ L
Sbjct: 164 KAKLE----FSIYPAPQVSTAVVEPYNSIL 189



 Score = 46.0 bits (104), Expect = 3e-05
 Identities = 20/51 (39%), Positives = 27/51 (52%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDLNSKGSTCTT 282
           MRE+I++ +G  G QIG   WE+   EHGI P G    D  L     + +T
Sbjct: 1   MREVISIHIGQAGVQIGNACWELYCLEHGIQPDGQMPSDKSLGGSDDSFST 51


>D21134-1|BAA22203.1|  449|Caenorhabditis elegans alpha-3 tubulin
           protein.
          Length = 449

 Score = 87.4 bits (207), Expect = 9e-18
 Identities = 50/150 (33%), Positives = 81/150 (54%), Gaps = 7/150 (4%)
 Frame = +3

Query: 261 ERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWAKG 440
           +  + +++E  +G++VPR V++DL+P  +D +R+G +  LF P+  + G+  AANN+A+G
Sbjct: 46  DSFSTFFSETGSGRHVPRAVMVDLEPTVIDEIRTGTYRSLFHPEQLITGKEDAANNYARG 105

Query: 441 HYTEGVEILESALDVIRREA------EGWIAC-KFSDVTLARWRYRFRIRYATS*TGYAK 599
           HYT G EI++  LD IRR A      +G++    F   T + +      R +     Y K
Sbjct: 106 HYTIGKEIIDLTLDRIRRLADNCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVD---YGK 162

Query: 600 SIPTELY*PFQSFQVPECRICVVEPYNTTL 689
               E    F  +  P+    VVEPYN+ L
Sbjct: 163 KAKLE----FSIYPAPQVSTAVVEPYNSIL 188



 Score = 44.0 bits (99), Expect = 1e-04
 Identities = 19/50 (38%), Positives = 26/50 (52%)
 Frame = +1

Query: 133 REIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDLNSKGSTCTT 282
           RE+I++ +G  G QIG   WE+   EHGI P G    D  L     + +T
Sbjct: 1   REVISIHIGQAGVQIGNACWELYCLEHGIQPDGQMPSDKSLGGSDDSFST 50


>AF003387-1|AAB54263.2|  450|Caenorhabditis elegans Mechanosensory
           abnormality protein12 protein.
          Length = 450

 Score = 87.4 bits (207), Expect = 9e-18
 Identities = 50/150 (33%), Positives = 81/150 (54%), Gaps = 7/150 (4%)
 Frame = +3

Query: 261 ERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWAKG 440
           +  + +++E  +G++VPR V++DL+P  +D +R+G +  LF P+  + G+  AANN+A+G
Sbjct: 47  DSFSTFFSETGSGRHVPRAVMVDLEPTVIDEIRTGTYRSLFHPEQLITGKEDAANNYARG 106

Query: 441 HYTEGVEILESALDVIRREA------EGWIAC-KFSDVTLARWRYRFRIRYATS*TGYAK 599
           HYT G EI++  LD IRR A      +G++    F   T + +      R +     Y K
Sbjct: 107 HYTIGKEIIDLTLDRIRRLADNCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVD---YGK 163

Query: 600 SIPTELY*PFQSFQVPECRICVVEPYNTTL 689
               E    F  +  P+    VVEPYN+ L
Sbjct: 164 KAKLE----FSIYPAPQVSTAVVEPYNSIL 189



 Score = 46.0 bits (104), Expect = 3e-05
 Identities = 20/51 (39%), Positives = 27/51 (52%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDLNSKGSTCTT 282
           MRE+I++ +G  G QIG   WE+   EHGI P G    D  L     + +T
Sbjct: 1   MREVISIHIGQAGVQIGNACWELYCLEHGIQPDGQMPSDKSLGGSDDSFST 51


>AB017190-1|BAA32600.1|  450|Caenorhabditis elegans Alpha tubulin
           (tba-3) protein.
          Length = 450

 Score = 87.4 bits (207), Expect = 9e-18
 Identities = 50/150 (33%), Positives = 81/150 (54%), Gaps = 7/150 (4%)
 Frame = +3

Query: 261 ERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWAKG 440
           +  + +++E  +G++VPR V++DL+P  +D +R+G +  LF P+  + G+  AANN+A+G
Sbjct: 47  DSFSTFFSETGSGRHVPRAVMVDLEPTVIDEIRTGTYRSLFHPEQLITGKEDAANNYARG 106

Query: 441 HYTEGVEILESALDVIRREA------EGWIAC-KFSDVTLARWRYRFRIRYATS*TGYAK 599
           HYT G EI++  LD IRR A      +G++    F   T + +      R +     Y K
Sbjct: 107 HYTIGKEIIDLTLDRIRRLADNCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVD---YGK 163

Query: 600 SIPTELY*PFQSFQVPECRICVVEPYNTTL 689
               E    F  +  P+    VVEPYN+ L
Sbjct: 164 KAKLE----FSIYPAPQVSTAVVEPYNSIL 189



 Score = 46.0 bits (104), Expect = 3e-05
 Identities = 20/51 (39%), Positives = 27/51 (52%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDLNSKGSTCTT 282
           MRE+I++ +G  G QIG   WE+   EHGI P G    D  L     + +T
Sbjct: 1   MREVISIHIGQAGVQIGNACWELYCLEHGIQPDGQMPSDKSLGGSDDSFST 51


>Z81070-8|CAB03001.1|  449|Caenorhabditis elegans Hypothetical
           protein F26E4.8 protein.
          Length = 449

 Score = 87.0 bits (206), Expect = 1e-17
 Identities = 48/150 (32%), Positives = 79/150 (52%), Gaps = 7/150 (4%)
 Frame = +3

Query: 261 ERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWAKG 440
           E    ++++   G+YVPR++ +DL+P  +D +R+G +  LF P+  + G+  AANN+A+G
Sbjct: 45  ESFTTFFSDTGNGRYVPRSIFVDLEPTVVDEIRTGTYKKLFHPEQMITGKEDAANNYARG 104

Query: 441 HYTEGVEILESALDVIRREAEG-------WIACKFSDVTLARWRYRFRIRYATS*TGYAK 599
           HYT G E++++ LD IRR A+        ++   F   T + +      R +     Y K
Sbjct: 105 HYTVGKELIDTVLDRIRRLADNCSGLQGFFVFHSFGGGTGSGFTSLLMERLSVD---YGK 161

Query: 600 SIPTELY*PFQSFQVPECRICVVEPYNTTL 689
               E    F  +  P+    VVEPYN+ L
Sbjct: 162 KSKLE----FSIYPAPQVSTAVVEPYNSIL 187



 Score = 47.2 bits (107), Expect = 1e-05
 Identities = 25/58 (43%), Positives = 31/58 (53%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDLNSKGSTCTTTRHRLGN 303
           MRE+I++ VG  G QIG   WE+   EHGI P G     SD  + G + TT     GN
Sbjct: 1   MREVISIHVGQAGVQIGNACWELYCLEHGIQPDGTM--PSDQQADGESFTTFFSDTGN 56


>U40420-4|AAA81432.2|  456|Caenorhabditis elegans Tubulin, alpha
           protein 9 protein.
          Length = 456

 Score = 86.2 bits (204), Expect = 2e-17
 Identities = 34/81 (41%), Positives = 56/81 (69%)
 Frame = +3

Query: 261 ERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWAKG 440
           +  N +++E  AGK+VPR +++DL+P  +D +R+G +  LF P+  + G+  AANN+A+G
Sbjct: 52  DSFNTFFSETMAGKHVPRAIMVDLEPTPIDEIRTGTYKTLFHPEQLLTGKEDAANNYARG 111

Query: 441 HYTEGVEILESALDVIRREAE 503
           HYT G EI++  +D +RR  E
Sbjct: 112 HYTIGKEIIDVVMDRVRRLVE 132



 Score = 44.0 bits (99), Expect = 1e-04
 Identities = 18/44 (40%), Positives = 26/44 (59%)
 Frame = +1

Query: 124 NKMREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDL 255
           N+ RE+I++ VG  G Q+G   WE+   EHGI P G  + +  L
Sbjct: 4   NRSREVISIHVGQAGVQMGNACWELYCLEHGIQPDGMINEEDSL 47


>D16439-1|BAA03909.1|  449|Caenorhabditis elegans alpha-1 tubulin
           protein.
          Length = 449

 Score = 86.2 bits (204), Expect = 2e-17
 Identities = 48/150 (32%), Positives = 79/150 (52%), Gaps = 7/150 (4%)
 Frame = +3

Query: 261 ERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWAKG 440
           E    ++++   G+YVPR++ +DL+P  +D +R+G +  LF P+  + G+  AANN+A+G
Sbjct: 45  ESFTTFFSDTGNGRYVPRSIFVDLEPTVVDEIRTGTYKKLFHPEQMITGKEDAANNYARG 104

Query: 441 HYTEGVEILESALDVIRREAEG-------WIACKFSDVTLARWRYRFRIRYATS*TGYAK 599
           HYT G E++++ LD IRR A+        ++   F   T + +      R +     Y K
Sbjct: 105 HYTVGKELIDTVLDRIRRLADNCSGLQGFFVFHSFGGGTGSGFTSLLMERLSVD---YGK 161

Query: 600 SIPTELY*PFQSFQVPECRICVVEPYNTTL 689
               E    F  +  P+    VVEPYN+ L
Sbjct: 162 KSKLE----FSIYPAPQVCTAVVEPYNSIL 187



 Score = 47.2 bits (107), Expect = 1e-05
 Identities = 25/58 (43%), Positives = 31/58 (53%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDLNSKGSTCTTTRHRLGN 303
           MRE+I++ VG  G QIG   WE+   EHGI P G     SD  + G + TT     GN
Sbjct: 1   MREVISIHVGQAGVQIGNACWELYCLEHGIQPDGTM--PSDQQADGESFTTFFSDTGN 56


>Z37092-12|CAA85463.1|  448|Caenorhabditis elegans Hypothetical
           protein F44F4.11 protein.
          Length = 448

 Score = 85.0 bits (201), Expect = 5e-17
 Identities = 47/145 (32%), Positives = 78/145 (53%), Gaps = 7/145 (4%)
 Frame = +3

Query: 276 YYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWAKGHYTEG 455
           ++++   G+YVPR++ +DL+P  +D +R+G +  LF P+  + G+  AANN+A+GHYT G
Sbjct: 50  FFSDTGNGRYVPRSIFVDLEPTVVDEIRTGNYKKLFHPEQMITGKEDAANNYARGHYTVG 109

Query: 456 VEILESALDVIRREAEG-------WIACKFSDVTLARWRYRFRIRYATS*TGYAKSIPTE 614
            E++++ LD IRR A+        ++   F   T + +      R +     Y K    E
Sbjct: 110 KELIDTTLDRIRRLADNCSGLQGFFVFHSFGGGTGSGFTSLLMERLSVD---YGKKSKLE 166

Query: 615 LY*PFQSFQVPECRICVVEPYNTTL 689
               F  +  P+    VVEPYN+ L
Sbjct: 167 ----FSIYPAPQVSTAVVEPYNSIL 187



 Score = 46.4 bits (105), Expect = 2e-05
 Identities = 24/58 (41%), Positives = 32/58 (55%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDLNSKGSTCTTTRHRLGN 303
           MRE+I++ VG  G QIG   WE+   EHGI P G     S+  ++G + TT     GN
Sbjct: 1   MREVISIHVGQAGVQIGNACWELYCLEHGIQPDGTM--PSEQQNEGGSFTTFFSDTGN 56


>AL023832-2|CAA19476.1|  448|Caenorhabditis elegans Hypothetical
           protein F44F4.11 protein.
          Length = 448

 Score = 85.0 bits (201), Expect = 5e-17
 Identities = 47/145 (32%), Positives = 78/145 (53%), Gaps = 7/145 (4%)
 Frame = +3

Query: 276 YYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWAKGHYTEG 455
           ++++   G+YVPR++ +DL+P  +D +R+G +  LF P+  + G+  AANN+A+GHYT G
Sbjct: 50  FFSDTGNGRYVPRSIFVDLEPTVVDEIRTGNYKKLFHPEQMITGKEDAANNYARGHYTVG 109

Query: 456 VEILESALDVIRREAEG-------WIACKFSDVTLARWRYRFRIRYATS*TGYAKSIPTE 614
            E++++ LD IRR A+        ++   F   T + +      R +     Y K    E
Sbjct: 110 KELIDTTLDRIRRLADNCSGLQGFFVFHSFGGGTGSGFTSLLMERLSVD---YGKKSKLE 166

Query: 615 LY*PFQSFQVPECRICVVEPYNTTL 689
               F  +  P+    VVEPYN+ L
Sbjct: 167 ----FSIYPAPQVSTAVVEPYNSIL 187



 Score = 46.4 bits (105), Expect = 2e-05
 Identities = 24/58 (41%), Positives = 32/58 (55%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDLNSKGSTCTTTRHRLGN 303
           MRE+I++ VG  G QIG   WE+   EHGI P G     S+  ++G + TT     GN
Sbjct: 1   MREVISIHVGQAGVQIGNACWELYCLEHGIQPDGTM--PSEQQNEGGSFTTFFSDTGN 56


>Z78062-1|CAB01495.1|  447|Caenorhabditis elegans Hypothetical
           protein F16D3.1 protein.
          Length = 447

 Score = 84.6 bits (200), Expect = 6e-17
 Identities = 33/78 (42%), Positives = 54/78 (69%)
 Frame = +3

Query: 270 NVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWAKGHYT 449
           N +++E  +GK+VPR + +DL+P  +D VR+G +  LF P+  + G+  AANN+A+GHYT
Sbjct: 50  NTFFSETPSGKHVPRAIFVDLEPTVIDEVRTGTYAKLFHPEQLISGKEDAANNYARGHYT 109

Query: 450 EGVEILESALDVIRREAE 503
            G E+++  +D +RR  E
Sbjct: 110 IGKELIDVVMDRVRRLTE 127



 Score = 43.6 bits (98), Expect = 1e-04
 Identities = 19/51 (37%), Positives = 27/51 (52%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDLNSKGSTCTT 282
           MREI+++ +G  G QIG   WE+   EHGI P G    D+    +  +  T
Sbjct: 1   MREIVSIHIGQAGVQIGNACWELYCLEHGITPDGLMPDDTSYGVEDQSYNT 51


>Z81134-1|CAB03447.1|  444|Caenorhabditis elegans Hypothetical
           protein T28D6.2 protein.
          Length = 444

 Score = 84.2 bits (199), Expect = 8e-17
 Identities = 49/148 (33%), Positives = 80/148 (54%), Gaps = 7/148 (4%)
 Frame = +3

Query: 267 INVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWAKGHY 446
           +  ++++   G++VPR++ +DL+P  +D +R+G +  LF P+  + G+  AANN+A+GHY
Sbjct: 46  LGTFFSDTGYGRHVPRSIFVDLEPTVVDEIRTGAYKKLFHPEQMLTGKEDAANNYARGHY 105

Query: 447 TEGVEILESALDVIRREA---EG----WIACKFSDVTLARWRYRFRIRYATS*TGYAKSI 605
           T G EI+++ LD IRR A   EG    ++   F   T + +      R +     Y K  
Sbjct: 106 TVGKEIIDTTLDRIRRLANNCEGLQGFFVFHSFGGGTGSGFTSMLMERLSAE---YGKKS 162

Query: 606 PTELY*PFQSFQVPECRICVVEPYNTTL 689
             E    F  +  P+    VVEPYN+ L
Sbjct: 163 KLE----FSIYPAPQISTSVVEPYNSIL 186



 Score = 41.5 bits (93), Expect = 6e-04
 Identities = 18/34 (52%), Positives = 22/34 (64%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSG 231
           MRE+I++ VG  G QIG   WE+   EHGI P G
Sbjct: 1   MREVISIHVGQAGVQIGNACWELYCLEHGILPDG 34


>Z81523-9|CAB04246.2|  464|Caenorhabditis elegans Hypothetical
           protein F32H2.9 protein.
          Length = 464

 Score = 79.0 bits (186), Expect = 3e-15
 Identities = 49/152 (32%), Positives = 80/152 (52%), Gaps = 7/152 (4%)
 Frame = +3

Query: 255 QLERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWA 434
           + E IN ++ E + GK+VPR + +DL+P  +D VR+G +  LF P+  + G+  AAN +A
Sbjct: 51  ETETINTFFAETAGGKHVPRCLFVDLEPTVVDEVRTGTYRSLFHPEQLLSGKEDAANCYA 110

Query: 435 KGHYTEGVEILESALDVIRREAE------GWIAC-KFSDVTLARWRYRFRIRYATS*TGY 593
           +G YT G E+++  +D ++R AE      G++    F   T + +      R +T    Y
Sbjct: 111 RGRYTIGREMIDVVMDRVKRLAENCNGLQGFVIFHSFGGGTGSGFLSLLMERLSTE---Y 167

Query: 594 AKSIPTELY*PFQSFQVPECRICVVEPYNTTL 689
            K    E    F  +  P+    +VEPYN+ L
Sbjct: 168 GKKPKLE----FAIYPAPQVSTSMVEPYNSIL 195



 Score = 45.2 bits (102), Expect = 4e-05
 Identities = 20/40 (50%), Positives = 25/40 (62%)
 Frame = +1

Query: 133 REIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSD 252
           RE+I++ VG  G QIG   WE+   EHGI P G YH + D
Sbjct: 8   REVISIHVGQAGVQIGNACWELFCLEHGIQPDG-YHVEDD 46


>AB017191-1|BAA32601.1|  435|Caenorhabditis elegans alpha tubulin
           (tba-6) protein.
          Length = 435

 Score = 79.0 bits (186), Expect = 3e-15
 Identities = 49/152 (32%), Positives = 80/152 (52%), Gaps = 7/152 (4%)
 Frame = +3

Query: 255 QLERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWA 434
           + E IN ++ E + GK+VPR + +DL+P  +D VR+G +  LF P+  + G+  AAN +A
Sbjct: 23  ETETINTFFAETAGGKHVPRCLFVDLEPTVVDEVRTGTYRSLFHPEQLLSGKEDAANCYA 82

Query: 435 KGHYTEGVEILESALDVIRREAE------GWIAC-KFSDVTLARWRYRFRIRYATS*TGY 593
           +G YT G E+++  +D ++R AE      G++    F   T + +      R +T    Y
Sbjct: 83  RGRYTIGREMIDVVMDRVKRLAENCNGLQGFVIFHSFGGGTGSGFLSLLMERLSTE---Y 139

Query: 594 AKSIPTELY*PFQSFQVPECRICVVEPYNTTL 689
            K    E    F  +  P+    +VEPYN+ L
Sbjct: 140 GKKPKLE----FAIYPAPQVSTSMVEPYNSIL 167


>Z22179-11|CAA80164.1|  444|Caenorhabditis elegans Hypothetical
           protein F58A4.8 protein.
          Length = 444

 Score = 60.5 bits (140), Expect = 1e-09
 Identities = 32/84 (38%), Positives = 48/84 (57%), Gaps = 3/84 (3%)
 Frame = +3

Query: 261 ERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGP-FGCLFRPDNFVYGQN--CAANNW 431
           ++ ++ + +A    YVPR VL+DL+P  ++ +   P F  LF  DN     +   A NNW
Sbjct: 47  DKKDLLFYQADDDHYVPRAVLVDLEPRVINGMMQSPNFSNLFNTDNIFMSDHGGGAGNNW 106

Query: 432 AKGHYTEGVEILESALDVIRREAE 503
           A G Y +G E+ E  +D+I REAE
Sbjct: 107 ASG-YCQGQEVQEKIMDIIIREAE 129



 Score = 44.4 bits (100), Expect = 8e-05
 Identities = 17/42 (40%), Positives = 26/42 (61%)
 Frame = +1

Query: 139 IINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDLNSK 264
           ++ + VG CGNQ+   FW+ + DEHGI+  G    + D+N K
Sbjct: 7   LMTVHVGQCGNQLAQAFWKSMVDEHGINERGQTTHEDDMNDK 48


>AF287259-1|AAG24513.1|  444|Caenorhabditis elegans gamma-tubulin
           protein.
          Length = 444

 Score = 60.5 bits (140), Expect = 1e-09
 Identities = 32/84 (38%), Positives = 48/84 (57%), Gaps = 3/84 (3%)
 Frame = +3

Query: 261 ERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGP-FGCLFRPDNFVYGQN--CAANNW 431
           ++ ++ + +A    YVPR VL+DL+P  ++ +   P F  LF  DN     +   A NNW
Sbjct: 47  DKKDLLFYQADDDHYVPRAVLVDLEPRVINGMMQSPNFSNLFNTDNIFMSDHGGGAGNNW 106

Query: 432 AKGHYTEGVEILESALDVIRREAE 503
           A G Y +G E+ E  +D+I REAE
Sbjct: 107 ASG-YCQGQEVQEKIMDIIIREAE 129



 Score = 44.4 bits (100), Expect = 8e-05
 Identities = 17/42 (40%), Positives = 26/42 (61%)
 Frame = +1

Query: 139 IINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDLNSK 264
           ++ + VG CGNQ+   FW+ + DEHGI+  G    + D+N K
Sbjct: 7   LMTVHVGQCGNQLAQAFWKSMVDEHGINERGQTTHEDDMNDK 48


>AF038606-7|AAB92021.1|  344|Caenorhabditis elegans Hypothetical
           protein C04C3.6 protein.
          Length = 344

 Score = 32.7 bits (71), Expect = 0.26
 Identities = 24/65 (36%), Positives = 35/65 (53%), Gaps = 4/65 (6%)
 Frame = -3

Query: 452 FSVVSLR-PVVGR---TVLSVDEIVRSE*ASEGSRPHRVHRGRLQVDKNRARNIFPSRCL 285
           FSV+ +R P   +   T++S DEIV  E   E S    VH+ ++ +D  R RN    RCL
Sbjct: 215 FSVLIMRNPCTSKNAFTLISADEIVHHESTDEKSPLKIVHKSKIMLDIRR-RNDAIRRCL 273

Query: 284 VVVHV 270
           ++  V
Sbjct: 274 LLATV 278


>Z72506-3|CAA96617.1|  310|Caenorhabditis elegans Hypothetical
           protein F07A5.2 protein.
          Length = 310

 Score = 29.9 bits (64), Expect = 1.8
 Identities = 25/76 (32%), Positives = 41/76 (53%), Gaps = 7/76 (9%)
 Frame = +1

Query: 235 YHGDSDLN--SKGSTCTTTRHRLGNMFLARFLST*SRPR-WTR*GRDPSDAY----SDRT 393
           Y G+SD    S G+T +++R    + FL+   S+ SRPR  ++  R  S  +    S+R+
Sbjct: 27  YDGESDSTFVSTGTTPSSSRRSRLDSFLSTTSSSKSRPRIKSKLPRSSSSGFSGTGSERS 86

Query: 394 ISSTDKTVRPTTGRRD 441
           ISS    +  T+G R+
Sbjct: 87  ISSKRSKIGNTSGNRN 102


>U41992-5|AAA83356.1|  549|Caenorhabditis elegans Hypothetical
           protein F32E10.5 protein.
          Length = 549

 Score = 29.9 bits (64), Expect = 1.8
 Identities = 13/39 (33%), Positives = 24/39 (61%), Gaps = 1/39 (2%)
 Frame = -3

Query: 368 GSRPHRVHRGRLQVDKNRARNI-FPSRCLVVVHVDPFEL 255
           G+  HR+ RG++   +N  RNI + +RC +    +PF++
Sbjct: 193 GAVIHRMDRGKVDQFQNMIRNIDYLARCQITTCTEPFQI 231


>AF024496-2|AAB70340.1| 1459|Caenorhabditis elegans Hypothetical
           protein ZC178.2 protein.
          Length = 1459

 Score = 29.5 bits (63), Expect = 2.4
 Identities = 14/47 (29%), Positives = 26/47 (55%)
 Frame = +2

Query: 206 TSTASIQADATTATPTSTRKDQRVLQRGIGWEICSSHGSYRLEAGHD 346
           TST ++ +D+TTA P+ST  +    +     E  +S G++ +   +D
Sbjct: 720 TSTMTVSSDSTTAGPSSTATNSASSETPCNSETQTSDGTFTMTVPND 766



 Score = 28.3 bits (60), Expect = 5.5
 Identities = 14/47 (29%), Positives = 25/47 (53%)
 Frame = +2

Query: 206 TSTASIQADATTATPTSTRKDQRVLQRGIGWEICSSHGSYRLEAGHD 346
           TST ++  D+TTA P+ST  +    +     E  +S G++ +   +D
Sbjct: 796 TSTMTVSNDSTTAGPSSTATNSASSETPCNSETQTSDGTFTMTVPND 842



 Score = 27.5 bits (58), Expect = 9.6
 Identities = 13/47 (27%), Positives = 24/47 (51%)
 Frame = +2

Query: 206 TSTASIQADATTATPTSTRKDQRVLQRGIGWEICSSHGSYRLEAGHD 346
           TST ++ +D+TT  P+ST  +    +     E  +S G++ +    D
Sbjct: 454 TSTMTVSSDSTTPGPSSTATNSASSETPCNSETQTSDGTFTMTVSSD 500



 Score = 27.5 bits (58), Expect = 9.6
 Identities = 14/47 (29%), Positives = 24/47 (51%)
 Frame = +2

Query: 206 TSTASIQADATTATPTSTRKDQRVLQRGIGWEICSSHGSYRLEAGHD 346
           TST ++ +D+TTA P+ST  +    +     E  +S G+  +    D
Sbjct: 644 TSTMTVSSDSTTAGPSSTATNSASSETPCNSETQTSDGTSTMTVSSD 690



 Score = 27.5 bits (58), Expect = 9.6
 Identities = 14/47 (29%), Positives = 24/47 (51%)
 Frame = +2

Query: 206 TSTASIQADATTATPTSTRKDQRVLQRGIGWEICSSHGSYRLEAGHD 346
           TST ++ +D+TTA P+ST  +    +     E  +S G+  +    D
Sbjct: 682 TSTMTVSSDSTTAGPSSTATNSASSETPCNSETQTSDGTSTMTVSSD 728


>Z81579-9|CAN99688.1|  225|Caenorhabditis elegans Hypothetical
           protein R13H4.2a protein.
          Length = 225

 Score = 29.1 bits (62), Expect = 3.2
 Identities = 13/25 (52%), Positives = 18/25 (72%)
 Frame = +2

Query: 149 SRSVLVETKSAESSGR*YLTSTASI 223
           SRS LV ++S E S R Y+T T+S+
Sbjct: 13  SRSALVRSRSVEPSSRLYVTRTSSV 37


>AL110485-3|CAB60351.1| 2145|Caenorhabditis elegans Hypothetical
            protein Y46G5A.4 protein.
          Length = 2145

 Score = 28.3 bits (60), Expect = 5.5
 Identities = 13/33 (39%), Positives = 18/33 (54%)
 Frame = +3

Query: 300  KYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNF 398
            KY P T L+DL+P  + AV +  F  +F    F
Sbjct: 1287 KYPPPTELLDLQPLPISAVTNKEFQTVFAESGF 1319


>U42839-4|AAM54197.1|  114|Caenorhabditis elegans Hypothetical
           protein F11C7.7 protein.
          Length = 114

 Score = 27.9 bits (59), Expect = 7.3
 Identities = 9/20 (45%), Positives = 13/20 (65%)
 Frame = -2

Query: 447 CSVPSPSCWPHSFVRRRNCP 388
           C  PSPSC PH++ +  + P
Sbjct: 86  CMAPSPSCCPHTYKKTVDIP 105


>U23525-10|AAC46571.2|  503|Caenorhabditis elegans Hypothetical
           protein K11G12.6a protein.
          Length = 503

 Score = 27.9 bits (59), Expect = 7.3
 Identities = 10/22 (45%), Positives = 14/22 (63%)
 Frame = +2

Query: 296 WEICSSHGSYRLEAGHDGRGEV 361
           W + +S+GSYR   G  GR E+
Sbjct: 290 WSVANSYGSYRQMTGTHGRPEI 311


>U23525-9|ABC71820.1|  766|Caenorhabditis elegans Hypothetical
           protein K11G12.6b protein.
          Length = 766

 Score = 27.9 bits (59), Expect = 7.3
 Identities = 10/22 (45%), Positives = 14/22 (63%)
 Frame = +2

Query: 296 WEICSSHGSYRLEAGHDGRGEV 361
           W + +S+GSYR   G  GR E+
Sbjct: 553 WSVANSYGSYRQMTGTHGRPEI 574


>Z73098-2|CAA97331.2| 1058|Caenorhabditis elegans Hypothetical
           protein T21C9.2 protein.
          Length = 1058

 Score = 27.5 bits (58), Expect = 9.6
 Identities = 10/29 (34%), Positives = 20/29 (68%)
 Frame = +3

Query: 432 AKGHYTEGVEILESALDVIRREAEGWIAC 518
           ++G Y + +E +E++LDV+ +E  G + C
Sbjct: 407 SQGDYPKAIECIETSLDVLSKELNG-VTC 434


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 15,676,427
Number of Sequences: 27780
Number of extensions: 323314
Number of successful extensions: 1051
Number of sequences better than 10.0: 36
Number of HSP's better than 10.0 without gapping: 907
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1049
length of database: 12,740,198
effective HSP length: 79
effective length of database: 10,545,578
effective search space used: 1592382278
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -