SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30122.Seq
         (669 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF003139-2|AAB54165.1|  244|Caenorhabditis elegans Ribosomal pro...    91   7e-19
AL117202-24|CAD27612.1|  565|Caenorhabditis elegans Hypothetical...    31   0.74 
Z68333-3|CAA92726.2| 1694|Caenorhabditis elegans Hypothetical pr...    29   3.0  
AY726541-1|AAU25950.1| 1694|Caenorhabditis elegans GTL-1 protein.      29   3.0  
AJ276019-1|CAC81667.1| 1681|Caenorhabditis elegans putative TRP ...    29   3.0  
Z83238-7|CAB05797.1|  313|Caenorhabditis elegans Hypothetical pr...    28   6.9  
Z73910-2|CAA98138.1|  248|Caenorhabditis elegans Hypothetical pr...    27   9.1  
U05038-1|AAA61872.1|  248|Caenorhabditis elegans 14-3-3 protein ...    27   9.1  

>AF003139-2|AAB54165.1|  244|Caenorhabditis elegans Ribosomal
           protein, large subunitprotein 7 protein.
          Length = 244

 Score = 91.1 bits (216), Expect = 7e-19
 Identities = 43/85 (50%), Positives = 56/85 (65%)
 Frame = +1

Query: 361 RKVLQLFRLRQINNGVFVRLNKATVNMLRIAEPYIAWGYPNLKSVRELVSNVDSPS*VDN 540
           RK LQ+ RLRQINNGVFV+LNKAT+ +LRI EPY+AWGYPN K++ +L+          N
Sbjct: 102 RKALQILRLRQINNGVFVKLNKATLPLLRIIEPYVAWGYPNNKTIHDLLYKRGYAKVDGN 161

Query: 541 VYQSLPTALLRRGFHKHNIICVEDL 615
                   ++ +   K NIIC+EDL
Sbjct: 162 RVPITDNTIVEQSLGKFNIICLEDL 186



 Score = 45.2 bits (102), Expect = 4e-05
 Identities = 19/29 (65%), Positives = 24/29 (82%)
 Frame = +2

Query: 281 GNYYVPGEAKLAFVIRIRGINQVSPKSVK 367
           G++YVP E K+AFV+RIRGINQ+ PK  K
Sbjct: 75  GDFYVPAEHKVAFVVRIRGINQLHPKPRK 103



 Score = 43.2 bits (97), Expect = 2e-04
 Identities = 22/60 (36%), Positives = 34/60 (56%)
 Frame = +3

Query: 69  SKKLPAVPESVLKHXXXXXXXXXXXLQVTLKRRSSAIKKKREIFKRAEQYVKEYRIKERD 248
           +KK+P VPE+VLK             Q  +   +   +KK + FKRAE+YV+EYR  +++
Sbjct: 4   TKKVPQVPETVLKRRKQRADARTKAAQHKVTVAAKNKEKKTQYFKRAEKYVQEYRNAQKE 63


>AL117202-24|CAD27612.1|  565|Caenorhabditis elegans Hypothetical
           protein Y47D3A.30 protein.
          Length = 565

 Score = 31.1 bits (67), Expect = 0.74
 Identities = 15/43 (34%), Positives = 23/43 (53%)
 Frame = -1

Query: 477 VSPSNVRLGDT*HIHSSLIQTYKHTIVYLAQSKQLQNFTDFGE 349
           ++PS  RL    H H+ L Q +++ I    Q K++Q F   GE
Sbjct: 496 LAPSGTRLSTVRHTHTLLFQIWQYKINSFCQIKKIQFFVVCGE 538


>Z68333-3|CAA92726.2| 1694|Caenorhabditis elegans Hypothetical protein
            C05C12.3 protein.
          Length = 1694

 Score = 29.1 bits (62), Expect = 3.0
 Identities = 15/45 (33%), Positives = 23/45 (51%)
 Frame = +1

Query: 289  LRSRGSQIGICHPNPWYQPSFTEVRKVLQLFRLRQINNGVFVRLN 423
            L  R  Q+      PW  P FT +  V+ LF+L + ++ +F R N
Sbjct: 1346 LFERYGQVMEYESTPWLPPPFTIIYHVIWLFKLIKSSSRMFERKN 1390


>AY726541-1|AAU25950.1| 1694|Caenorhabditis elegans GTL-1 protein.
          Length = 1694

 Score = 29.1 bits (62), Expect = 3.0
 Identities = 15/45 (33%), Positives = 23/45 (51%)
 Frame = +1

Query: 289  LRSRGSQIGICHPNPWYQPSFTEVRKVLQLFRLRQINNGVFVRLN 423
            L  R  Q+      PW  P FT +  V+ LF+L + ++ +F R N
Sbjct: 1346 LFERYGQVMEYESTPWLPPPFTIIYHVIWLFKLIKSSSRMFERKN 1390


>AJ276019-1|CAC81667.1| 1681|Caenorhabditis elegans putative TRP
            homologous cationchannel protein.
          Length = 1681

 Score = 29.1 bits (62), Expect = 3.0
 Identities = 15/45 (33%), Positives = 23/45 (51%)
 Frame = +1

Query: 289  LRSRGSQIGICHPNPWYQPSFTEVRKVLQLFRLRQINNGVFVRLN 423
            L  R  Q+      PW  P FT +  V+ LF+L + ++ +F R N
Sbjct: 1333 LFERYGQVMEYESTPWLPPPFTIIYHVIWLFKLIKSSSRMFERKN 1377


>Z83238-7|CAB05797.1|  313|Caenorhabditis elegans Hypothetical
           protein T08G3.8 protein.
          Length = 313

 Score = 27.9 bits (59), Expect = 6.9
 Identities = 15/61 (24%), Positives = 32/61 (52%)
 Frame = -3

Query: 229 YSLTYCSALLKISLFFLMAEERLFSVTCNLLVRRASLLLRCLSTDSGTAGSFLLSSFPLT 50
           YS+     L+K+S +FL  + + +S   + ++ R  ++++ ++        FL+   PLT
Sbjct: 24  YSMPTVYILIKLSYYFLYRKNKCYSTDLHPVLFRQFMIMQ-IACFFNVCIKFLIFRIPLT 82

Query: 49  G 47
           G
Sbjct: 83  G 83


>Z73910-2|CAA98138.1|  248|Caenorhabditis elegans Hypothetical
           protein M117.2 protein.
          Length = 248

 Score = 27.5 bits (58), Expect = 9.1
 Identities = 11/29 (37%), Positives = 20/29 (68%)
 Frame = +3

Query: 171 SAIKKKREIFKRAEQYVKEYRIKERDEID 257
           S+I++K E  ++ +Q  KEYR+K   E++
Sbjct: 65  SSIEQKTEGSEKKQQLAKEYRVKVEQELN 93


>U05038-1|AAA61872.1|  248|Caenorhabditis elegans 14-3-3 protein
           protein.
          Length = 248

 Score = 27.5 bits (58), Expect = 9.1
 Identities = 11/29 (37%), Positives = 20/29 (68%)
 Frame = +3

Query: 171 SAIKKKREIFKRAEQYVKEYRIKERDEID 257
           S+I++K E  ++ +Q  KEYR+K   E++
Sbjct: 65  SSIEQKTEGSEKKQQLAKEYRVKVEQELN 93


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 14,063,827
Number of Sequences: 27780
Number of extensions: 288178
Number of successful extensions: 803
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 776
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 800
length of database: 12,740,198
effective HSP length: 79
effective length of database: 10,545,578
effective search space used: 1508017654
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -