SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30120.Seq
         (576 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z50872-7|CAJ55249.1| 1001|Caenorhabditis elegans Hypothetical pr...    30   1.4  
Z50872-6|CAH10768.1| 1039|Caenorhabditis elegans Hypothetical pr...    30   1.4  
U38378-4|AAA79749.1|  502|Caenorhabditis elegans Hypothetical pr...    28   5.5  
U23523-1|AAC46560.2|  305|Caenorhabditis elegans Hypothetical pr...    27   7.2  
S47168-2|AAB23866.2|  919|Caenorhabditis elegans UNC-5 protein.        27   9.5  
S47168-1|AAB23867.2|  947|Caenorhabditis elegans UNC-5 protein.        27   9.5  
AF036698-5|AAB88356.2|  567|Caenorhabditis elegans Uncoordinated...    27   9.5  
AF036698-4|AAB88355.1|  919|Caenorhabditis elegans Uncoordinated...    27   9.5  

>Z50872-7|CAJ55249.1| 1001|Caenorhabditis elegans Hypothetical
           protein C05D12.3c protein.
          Length = 1001

 Score = 29.9 bits (64), Expect = 1.4
 Identities = 19/60 (31%), Positives = 25/60 (41%)
 Frame = -3

Query: 538 DGGMAQNSVLCRCRLIYWVYQSFVPS*WKVQPWGRPLSQVAQCVCGPRQYPAHRPIHSCR 359
           +GG   NS  C+C       +  +    K Q WG P     +CVC P  Y  +  I  CR
Sbjct: 25  NGGTPINSTACQCPAFVAGERCEIV---KCQRWGIPDKD--RCVCAPGWYDKYCGIRGCR 79


>Z50872-6|CAH10768.1| 1039|Caenorhabditis elegans Hypothetical
           protein C05D12.3a protein.
          Length = 1039

 Score = 29.9 bits (64), Expect = 1.4
 Identities = 19/60 (31%), Positives = 25/60 (41%)
 Frame = -3

Query: 538 DGGMAQNSVLCRCRLIYWVYQSFVPS*WKVQPWGRPLSQVAQCVCGPRQYPAHRPIHSCR 359
           +GG   NS  C+C       +  +    K Q WG P     +CVC P  Y  +  I  CR
Sbjct: 25  NGGTPINSTACQCPAFVAGERCEIV---KCQRWGIPDKD--RCVCAPGWYDKYCGIRGCR 79


>U38378-4|AAA79749.1|  502|Caenorhabditis elegans Hypothetical
           protein R11F4.1 protein.
          Length = 502

 Score = 27.9 bits (59), Expect = 5.5
 Identities = 10/29 (34%), Positives = 19/29 (65%)
 Frame = -2

Query: 506 QMQADLLGIPVIRPLMMESTALGAAIVAG 420
           ++QAD++G  ++ P + E +  GAA+  G
Sbjct: 425 EIQADIMGRDIVTPKITEISGWGAAVAGG 453


>U23523-1|AAC46560.2|  305|Caenorhabditis elegans Hypothetical
           protein F53A9.5 protein.
          Length = 305

 Score = 27.5 bits (58), Expect = 7.2
 Identities = 8/16 (50%), Positives = 11/16 (68%)
 Frame = -3

Query: 457 WKVQPWGRPLSQVAQC 410
           W+  PW  P+S +AQC
Sbjct: 121 WRSTPWTLPISNIAQC 136


>S47168-2|AAB23866.2|  919|Caenorhabditis elegans UNC-5 protein.
          Length = 919

 Score = 27.1 bits (57), Expect = 9.5
 Identities = 17/61 (27%), Positives = 23/61 (37%)
 Frame = +3

Query: 390 YCRGPHTHCATCDNGRPQGCTFHHEGTNDWYTQ*ISLHLHRTEFCAIPPSARSCLRGAQX 569
           YC+G      +C    P          +DW     S H +RT  C +PP     + G Q 
Sbjct: 256 YCKGEEEMTRSCKV--PCKLDGGWSSWSDWSACSSSCHRYRTRACTVPPP----MNGGQP 309

Query: 570 C 572
           C
Sbjct: 310 C 310


>S47168-1|AAB23867.2|  947|Caenorhabditis elegans UNC-5 protein.
          Length = 947

 Score = 27.1 bits (57), Expect = 9.5
 Identities = 17/61 (27%), Positives = 23/61 (37%)
 Frame = +3

Query: 390 YCRGPHTHCATCDNGRPQGCTFHHEGTNDWYTQ*ISLHLHRTEFCAIPPSARSCLRGAQX 569
           YC+G      +C    P          +DW     S H +RT  C +PP     + G Q 
Sbjct: 284 YCKGEEEMTRSCKV--PCKLDGGWSSWSDWSACSSSCHRYRTRACTVPPP----MNGGQP 337

Query: 570 C 572
           C
Sbjct: 338 C 338


>AF036698-5|AAB88356.2|  567|Caenorhabditis elegans Uncoordinated
           protein 5, isoform b protein.
          Length = 567

 Score = 27.1 bits (57), Expect = 9.5
 Identities = 17/61 (27%), Positives = 23/61 (37%)
 Frame = +3

Query: 390 YCRGPHTHCATCDNGRPQGCTFHHEGTNDWYTQ*ISLHLHRTEFCAIPPSARSCLRGAQX 569
           YC+G      +C    P          +DW     S H +RT  C +PP     + G Q 
Sbjct: 256 YCKGEEEMTRSCKV--PCKLDGGWSSWSDWSACSSSCHRYRTRACTVPPP----MNGGQP 309

Query: 570 C 572
           C
Sbjct: 310 C 310


>AF036698-4|AAB88355.1|  919|Caenorhabditis elegans Uncoordinated
           protein 5, isoform a protein.
          Length = 919

 Score = 27.1 bits (57), Expect = 9.5
 Identities = 17/61 (27%), Positives = 23/61 (37%)
 Frame = +3

Query: 390 YCRGPHTHCATCDNGRPQGCTFHHEGTNDWYTQ*ISLHLHRTEFCAIPPSARSCLRGAQX 569
           YC+G      +C    P          +DW     S H +RT  C +PP     + G Q 
Sbjct: 256 YCKGEEEMTRSCKV--PCKLDGGWSSWSDWSACSSSCHRYRTRACTVPPP----MNGGQP 309

Query: 570 C 572
           C
Sbjct: 310 C 310


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 13,057,482
Number of Sequences: 27780
Number of extensions: 298628
Number of successful extensions: 603
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 594
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 603
length of database: 12,740,198
effective HSP length: 78
effective length of database: 10,573,358
effective search space used: 1194789454
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -