SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30119.Seq
         (448 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z82077-3|CAB63331.1|  122|Caenorhabditis elegans Hypothetical pr...   111   3e-25
Z82077-4|CAB63332.1|   70|Caenorhabditis elegans Hypothetical pr...    44   5e-05
AL034393-8|CAA22313.1|  241|Caenorhabditis elegans Hypothetical ...    27   6.2  

>Z82077-3|CAB63331.1|  122|Caenorhabditis elegans Hypothetical
           protein W09C5.6a protein.
          Length = 122

 Score =  111 bits (266), Expect = 3e-25
 Identities = 48/75 (64%), Positives = 62/75 (82%)
 Frame = +3

Query: 51  PKGERKGKSAINEVVTREYTVNLHKRLHGVGFKKRAPRAIKEIRKFAEKQMGTPDIRVDT 230
           PK E+K +S INEVVTREYT+++H R+ G+G KKRAPRAI EI+KFA+ QM T D+RVDT
Sbjct: 3   PKNEKKSRSTINEVVTREYTIHIHARIRGIGSKKRAPRAIDEIKKFAKIQMKTNDVRVDT 62

Query: 231 RLNKFLWSRGSEMFP 275
           +LNKF+WS+G +  P
Sbjct: 63  KLNKFIWSKGIKNVP 77



 Score = 44.0 bits (99), Expect = 5e-05
 Identities = 19/32 (59%), Positives = 23/32 (71%)
 Frame = +2

Query: 308 NDDEDSAHKLFTLVTYVPVASIKGLQTENVDA 403
           N+DEDSA KL+TL TYVP  +  GL   NVD+
Sbjct: 89  NEDEDSAQKLYTLCTYVPCTNFHGLTNVNVDS 120


>Z82077-4|CAB63332.1|   70|Caenorhabditis elegans Hypothetical
           protein W09C5.6b protein.
          Length = 70

 Score = 44.0 bits (99), Expect = 5e-05
 Identities = 19/32 (59%), Positives = 23/32 (71%)
 Frame = +2

Query: 308 NDDEDSAHKLFTLVTYVPVASIKGLQTENVDA 403
           N+DEDSA KL+TL TYVP  +  GL   NVD+
Sbjct: 37  NEDEDSAQKLYTLCTYVPCTNFHGLTNVNVDS 68



 Score = 38.7 bits (86), Expect = 0.002
 Identities = 15/25 (60%), Positives = 20/25 (80%)
 Frame = +3

Query: 201 MGTPDIRVDTRLNKFLWSRGSEMFP 275
           M T D+RVDT+LNKF+WS+G +  P
Sbjct: 1   MKTNDVRVDTKLNKFIWSKGIKNVP 25


>AL034393-8|CAA22313.1|  241|Caenorhabditis elegans Hypothetical
           protein Y18D10A.10 protein.
          Length = 241

 Score = 27.1 bits (57), Expect = 6.2
 Identities = 9/14 (64%), Positives = 10/14 (71%)
 Frame = -3

Query: 287 HGHGREHF*PPRPK 246
           HGHG  H  PPRP+
Sbjct: 49  HGHGHHHGRPPRPR 62


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 9,534,932
Number of Sequences: 27780
Number of extensions: 182651
Number of successful extensions: 423
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 402
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 423
length of database: 12,740,198
effective HSP length: 75
effective length of database: 10,656,698
effective search space used: 777938954
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -