SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30117.Seq
         (608 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z81525-8|CAB04257.1|  208|Caenorhabditis elegans Hypothetical pr...    88   4e-18
U88173-8|AAK21380.1|  267|Caenorhabditis elegans C.elegans y-box...    61   5e-10
Z73424-7|CAA97783.1|  294|Caenorhabditis elegans Hypothetical pr...    60   9e-10
AL023839-3|CAA19509.1|  294|Caenorhabditis elegans Hypothetical ...    60   9e-10
U80450-3|AAB37828.1|  265|Caenorhabditis elegans C.elegans y-box...    58   4e-09
Z81494-3|CAB61009.1|  196|Caenorhabditis elegans Hypothetical pr...    31   0.85 
Z81494-2|CAB61008.1|  227|Caenorhabditis elegans Hypothetical pr...    31   0.85 
U75915-1|AAB49759.1|  227|Caenorhabditis elegans Lin-28 protein.       31   0.85 
U75912-1|AAC47476.1|  227|Caenorhabditis elegans LIN-28 protein.       31   0.85 
U39999-14|ABF71722.1| 1483|Caenorhabditis elegans Hypothetical p...    28   6.0  
AM773423-1|CAO78927.1| 1473|Caenorhabditis elegans AGRin (synapt...    28   6.0  
Z74476-6|CAA98967.1| 1139|Caenorhabditis elegans Hypothetical pr...    27   7.9  
Z74473-6|CAA98951.1| 1139|Caenorhabditis elegans Hypothetical pr...    27   7.9  
U20168-1|AAA66364.1| 1139|Caenorhabditis elegans Lin-25 protein ...    27   7.9  

>Z81525-8|CAB04257.1|  208|Caenorhabditis elegans Hypothetical
           protein F33A8.3 protein.
          Length = 208

 Score = 88.2 bits (209), Expect = 4e-18
 Identities = 40/61 (65%), Positives = 46/61 (75%)
 Frame = +3

Query: 255 EDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPVKGSPYAAD 434
           ED+FVHQTAI  NNP K +RS+GD E V F +V G KG EAA VTGP G PV+GS YAAD
Sbjct: 44  EDIFVHQTAIINNNPNKYLRSLGDNEEVMFDIVEGSKGLEAASVTGPDGGPVQGSKYAAD 103

Query: 435 K 437
           +
Sbjct: 104 R 104



 Score = 51.6 bits (118), Expect = 4e-07
 Identities = 22/29 (75%), Positives = 24/29 (82%)
 Frame = +1

Query: 172 VIAEKVSGTVKWFNVKSGYGFINRNDTKK 258
           V A KV GTVKWFNVK+GYGFINR DT +
Sbjct: 16  VKATKVKGTVKWFNVKNGYGFINRTDTNE 44


>U88173-8|AAK21380.1|  267|Caenorhabditis elegans C.elegans y-box
           protein 2 protein.
          Length = 267

 Score = 61.3 bits (142), Expect = 5e-10
 Identities = 31/59 (52%), Positives = 42/59 (71%), Gaps = 1/59 (1%)
 Frame = +3

Query: 252 QEDVFVHQTAIARNNPRKA-VRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPVKGSPY 425
           ++D+FVHQTAIA++   K  +R++GD E V F +V G+ G EAA VTGP G+ V GS Y
Sbjct: 88  EKDIFVHQTAIAKSATEKFYLRTLGDDEEVLFDLVEGKNGPEAANVTGPNGDNVIGSRY 146



 Score = 35.1 bits (77), Expect = 0.040
 Identities = 20/53 (37%), Positives = 28/53 (52%)
 Frame = +1

Query: 175 IAEKVSGTVKWFNVKSGYGFINRNDTKKMCLCIRLPSPVTTHVRLCARSATER 333
           I   + G VKW++V   YGFI+RND +K          +  H    A+SATE+
Sbjct: 62  ITTGLQGKVKWYSVLRRYGFISRNDGEK---------DIFVHQTAIAKSATEK 105


>Z73424-7|CAA97783.1|  294|Caenorhabditis elegans Hypothetical
           protein Y39A1C.3 protein.
          Length = 294

 Score = 60.5 bits (140), Expect = 9e-10
 Identities = 32/59 (54%), Positives = 41/59 (69%), Gaps = 1/59 (1%)
 Frame = +3

Query: 255 EDVFVHQTAIARNNPRKA-VRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPVKGSPYA 428
           ED FVHQTAI +++  K  +R++ D E V F +V G KG EAA VTGP GE V+GS +A
Sbjct: 115 EDFFVHQTAITKSSTIKFYLRTLDDDEPVVFDIVEGLKGPEAANVTGPDGENVRGSRFA 173



 Score = 31.9 bits (69), Expect = 0.37
 Identities = 13/25 (52%), Positives = 17/25 (68%)
 Frame = +1

Query: 172 VIAEKVSGTVKWFNVKSGYGFINRN 246
           VI   V G VKWF+V+  YGF+ R+
Sbjct: 84  VIETGVKGHVKWFSVRGRYGFVARD 108


>AL023839-3|CAA19509.1|  294|Caenorhabditis elegans Hypothetical
           protein Y39A1C.3 protein.
          Length = 294

 Score = 60.5 bits (140), Expect = 9e-10
 Identities = 32/59 (54%), Positives = 41/59 (69%), Gaps = 1/59 (1%)
 Frame = +3

Query: 255 EDVFVHQTAIARNNPRKA-VRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPVKGSPYA 428
           ED FVHQTAI +++  K  +R++ D E V F +V G KG EAA VTGP GE V+GS +A
Sbjct: 115 EDFFVHQTAITKSSTIKFYLRTLDDDEPVVFDIVEGLKGPEAANVTGPDGENVRGSRFA 173



 Score = 31.9 bits (69), Expect = 0.37
 Identities = 13/25 (52%), Positives = 17/25 (68%)
 Frame = +1

Query: 172 VIAEKVSGTVKWFNVKSGYGFINRN 246
           VI   V G VKWF+V+  YGF+ R+
Sbjct: 84  VIETGVKGHVKWFSVRGRYGFVARD 108


>U80450-3|AAB37828.1|  265|Caenorhabditis elegans C.elegans y-box
           protein 3 protein.
          Length = 265

 Score = 58.4 bits (135), Expect = 4e-09
 Identities = 30/59 (50%), Positives = 41/59 (69%), Gaps = 1/59 (1%)
 Frame = +3

Query: 252 QEDVFVHQTAIARNNPRKA-VRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPVKGSPY 425
           ++DVFVHQTAI++++  K  +R++ D E V F +V G+ G EAA VTGP G  V GS Y
Sbjct: 86  EKDVFVHQTAISKSDTEKFYLRTLADEEEVLFDLVDGKNGPEAANVTGPAGVNVSGSKY 144



 Score = 33.1 bits (72), Expect = 0.16
 Identities = 13/29 (44%), Positives = 20/29 (68%)
 Frame = +1

Query: 172 VIAEKVSGTVKWFNVKSGYGFINRNDTKK 258
           V+   + G VKW++V   YGFI+R+D +K
Sbjct: 59  VLTAGLQGKVKWYSVLRRYGFISRSDGEK 87


>Z81494-3|CAB61009.1|  196|Caenorhabditis elegans Hypothetical
           protein F02E9.2b protein.
          Length = 196

 Score = 30.7 bits (66), Expect = 0.85
 Identities = 10/15 (66%), Positives = 12/15 (80%)
 Frame = +1

Query: 193 GTVKWFNVKSGYGFI 237
           G+ KWFNV  GYGF+
Sbjct: 24  GSCKWFNVSKGYGFV 38


>Z81494-2|CAB61008.1|  227|Caenorhabditis elegans Hypothetical
           protein F02E9.2a protein.
          Length = 227

 Score = 30.7 bits (66), Expect = 0.85
 Identities = 10/15 (66%), Positives = 12/15 (80%)
 Frame = +1

Query: 193 GTVKWFNVKSGYGFI 237
           G+ KWFNV  GYGF+
Sbjct: 55  GSCKWFNVSKGYGFV 69


>U75915-1|AAB49759.1|  227|Caenorhabditis elegans Lin-28 protein.
          Length = 227

 Score = 30.7 bits (66), Expect = 0.85
 Identities = 10/15 (66%), Positives = 12/15 (80%)
 Frame = +1

Query: 193 GTVKWFNVKSGYGFI 237
           G+ KWFNV  GYGF+
Sbjct: 55  GSCKWFNVSKGYGFV 69


>U75912-1|AAC47476.1|  227|Caenorhabditis elegans LIN-28 protein.
          Length = 227

 Score = 30.7 bits (66), Expect = 0.85
 Identities = 10/15 (66%), Positives = 12/15 (80%)
 Frame = +1

Query: 193 GTVKWFNVKSGYGFI 237
           G+ KWFNV  GYGF+
Sbjct: 55  GSCKWFNVSKGYGFV 69


>U39999-14|ABF71722.1| 1483|Caenorhabditis elegans Hypothetical
            protein F41G3.12 protein.
          Length = 1483

 Score = 27.9 bits (59), Expect = 6.0
 Identities = 11/38 (28%), Positives = 22/38 (57%), Gaps = 1/38 (2%)
 Frame = -3

Query: 303  YVGCYGRWQSDAQTHLLGVIPV-DETISTLDVEPFHSA 193
            YVG  G+W  +    ++G + + DE +   +++PF+ A
Sbjct: 1086 YVGTDGKWPRNRLNSIVGYLEIDDEPVRIDEIKPFYMA 1123


>AM773423-1|CAO78927.1| 1473|Caenorhabditis elegans AGRin (synaptic
            protein) homologfamily member protein.
          Length = 1473

 Score = 27.9 bits (59), Expect = 6.0
 Identities = 11/38 (28%), Positives = 22/38 (57%), Gaps = 1/38 (2%)
 Frame = -3

Query: 303  YVGCYGRWQSDAQTHLLGVIPV-DETISTLDVEPFHSA 193
            YVG  G+W  +    ++G + + DE +   +++PF+ A
Sbjct: 1038 YVGTDGKWPRNRLNSIVGYLEIDDEPVRIDEIKPFYMA 1075


>Z74476-6|CAA98967.1| 1139|Caenorhabditis elegans Hypothetical
           protein F56H9.5 protein.
          Length = 1139

 Score = 27.5 bits (58), Expect = 7.9
 Identities = 10/19 (52%), Positives = 15/19 (78%)
 Frame = -2

Query: 589 WYNASFLTLISLXTPLVGR 533
           W NASFLTL++   P++G+
Sbjct: 371 WQNASFLTLLNELEPVLGK 389


>Z74473-6|CAA98951.1| 1139|Caenorhabditis elegans Hypothetical
           protein F56H9.5 protein.
          Length = 1139

 Score = 27.5 bits (58), Expect = 7.9
 Identities = 10/19 (52%), Positives = 15/19 (78%)
 Frame = -2

Query: 589 WYNASFLTLISLXTPLVGR 533
           W NASFLTL++   P++G+
Sbjct: 371 WQNASFLTLLNELEPVLGK 389


>U20168-1|AAA66364.1| 1139|Caenorhabditis elegans Lin-25 protein
           protein.
          Length = 1139

 Score = 27.5 bits (58), Expect = 7.9
 Identities = 10/19 (52%), Positives = 15/19 (78%)
 Frame = -2

Query: 589 WYNASFLTLISLXTPLVGR 533
           W NASFLTL++   P++G+
Sbjct: 371 WQNASFLTLLNELEPVLGK 389


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 11,231,894
Number of Sequences: 27780
Number of extensions: 181179
Number of successful extensions: 634
Number of sequences better than 10.0: 14
Number of HSP's better than 10.0 without gapping: 564
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 630
length of database: 12,740,198
effective HSP length: 78
effective length of database: 10,573,358
effective search space used: 1311096392
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -