SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30115.Seq
         (690 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z49886-1|CAA90050.1|  809|Caenorhabditis elegans Hypothetical pr...   118   4e-27
Z48334-9|CAA88314.1|  810|Caenorhabditis elegans Hypothetical pr...   105   2e-23
Z48045-12|CAA88105.1|  810|Caenorhabditis elegans Hypothetical p...   105   2e-23
Z69904-3|CAA93780.1|  372|Caenorhabditis elegans Hypothetical pr...    29   4.1  
AF125450-3|AAD12817.1|  309|Caenorhabditis elegans Hypothetical ...    29   4.1  
Z83217-5|CAB05684.2| 1565|Caenorhabditis elegans Hypothetical pr...    28   5.5  
AM086627-1|CAJ31105.1| 1565|Caenorhabditis elegans KIN-4 protein...    28   5.5  
Z66562-5|CAA91466.1|  250|Caenorhabditis elegans Hypothetical pr...    28   7.2  
AB107358-1|BAD89379.1|  250|Caenorhabditis elegans troponin I 1 ...    28   7.2  
U23172-6|AAV58869.1|  484|Caenorhabditis elegans Hypothetical pr...    27   9.6  
U23172-5|AAC46527.1|  510|Caenorhabditis elegans Hypothetical pr...    27   9.6  
U23172-4|AAL02494.1|  521|Caenorhabditis elegans Hypothetical pr...    27   9.6  

>Z49886-1|CAA90050.1|  809|Caenorhabditis elegans Hypothetical
           protein C06A1.1 protein.
          Length = 809

 Score =  118 bits (284), Expect = 4e-27
 Identities = 48/87 (55%), Positives = 66/87 (75%)
 Frame = +2

Query: 254 LLSDDNCPDEKIRMXXXXXXXXXXXXSDVVSIAPCPSVKYGKRVHILPIDDSVEGLTGNL 433
           ++SD++CP+EK+RM             DVVSI P P++ YG R+H+LPIDD++EGLTGNL
Sbjct: 77  IVSDESCPNEKVRMNRVVRNNLRIRLGDVVSITPAPNLSYGTRIHVLPIDDTIEGLTGNL 136

Query: 434 FEVYLKPYFMEAYRPIHRDDTFMVRGA 514
           F+V+LKPYF+EAYRP+H+ D F V+ A
Sbjct: 137 FDVFLKPYFLEAYRPLHKGDIFTVQAA 163



 Score = 97.9 bits (233), Expect = 6e-21
 Identities = 41/56 (73%), Positives = 51/56 (91%)
 Frame = +1

Query: 514 MRAVEFKVVETDPSPFCIVAPDTVIHCDGEPIKREEEEEALNAVGYDDIGGCRKQL 681
           MR VEFKVVET+P+P CIV+PDT+IH +G+PIKREEEEE++N +GYDD+GG RKQL
Sbjct: 164 MRTVEFKVVETEPAPACIVSPDTMIHYEGDPIKREEEEESMNDIGYDDLGGVRKQL 219



 Score = 90.6 bits (215), Expect = 9e-19
 Identities = 42/64 (65%), Positives = 55/64 (85%)
 Frame = +3

Query: 63  KSPDDLSTAILRRKDRPNRLIVEEAVSDDNSVVALSQAKMEQLQLFRGDTVLLKGKRRKE 242
           K  D+LSTAIL+ K +PNRLIV+++  DDNSV+A+SQAKM++L LFRGD V+LKGK+RKE
Sbjct: 13  KKNDELSTAILKDKVKPNRLIVDQSEQDDNSVIAVSQAKMDELGLFRGDAVILKGKKRKE 72

Query: 243 TVCI 254
           +V I
Sbjct: 73  SVAI 76


>Z48334-9|CAA88314.1|  810|Caenorhabditis elegans Hypothetical
           protein C41C4.8 protein.
          Length = 810

 Score =  105 bits (253), Expect = 2e-23
 Identities = 46/87 (52%), Positives = 64/87 (73%)
 Frame = +2

Query: 254 LLSDDNCPDEKIRMXXXXXXXXXXXXSDVVSIAPCPSVKYGKRVHILPIDDSVEGLTGNL 433
           +L+ DNCP++KI+M             DVVSI+    ++YGKRVH+LPIDD++EGLTGNL
Sbjct: 77  VLNADNCPNDKIKMNKVVRNNLRSRLGDVVSISSA-QLEYGKRVHVLPIDDTIEGLTGNL 135

Query: 434 FEVYLKPYFMEAYRPIHRDDTFMVRGA 514
           F+V+L+PYF +AYRP+H+ D F V+ A
Sbjct: 136 FDVFLRPYFTDAYRPVHKGDIFTVQAA 162



 Score =  104 bits (250), Expect = 5e-23
 Identities = 47/56 (83%), Positives = 51/56 (91%)
 Frame = +1

Query: 514 MRAVEFKVVETDPSPFCIVAPDTVIHCDGEPIKREEEEEALNAVGYDDIGGCRKQL 681
           MR VEFKVVETDP+P CIVAPDTVIH +G+PIKREEEEEALN VGYDD+GG RKQL
Sbjct: 163 MRTVEFKVVETDPAPACIVAPDTVIHYEGDPIKREEEEEALNEVGYDDLGGVRKQL 218



 Score = 89.8 bits (213), Expect = 2e-18
 Identities = 41/64 (64%), Positives = 56/64 (87%)
 Frame = +3

Query: 63  KSPDDLSTAILRRKDRPNRLIVEEAVSDDNSVVALSQAKMEQLQLFRGDTVLLKGKRRKE 242
           K  D+L+TAIL+ K RPNRLI++++ +DDNS+V LSQAKM++L LFRGD+V+LKGK+R+E
Sbjct: 13  KKNDELATAILKDKKRPNRLIIDQSDNDDNSMVMLSQAKMDELGLFRGDSVILKGKKRRE 72

Query: 243 TVCI 254
           TV I
Sbjct: 73  TVSI 76


>Z48045-12|CAA88105.1|  810|Caenorhabditis elegans Hypothetical
           protein C41C4.8 protein.
          Length = 810

 Score =  105 bits (253), Expect = 2e-23
 Identities = 46/87 (52%), Positives = 64/87 (73%)
 Frame = +2

Query: 254 LLSDDNCPDEKIRMXXXXXXXXXXXXSDVVSIAPCPSVKYGKRVHILPIDDSVEGLTGNL 433
           +L+ DNCP++KI+M             DVVSI+    ++YGKRVH+LPIDD++EGLTGNL
Sbjct: 77  VLNADNCPNDKIKMNKVVRNNLRSRLGDVVSISSA-QLEYGKRVHVLPIDDTIEGLTGNL 135

Query: 434 FEVYLKPYFMEAYRPIHRDDTFMVRGA 514
           F+V+L+PYF +AYRP+H+ D F V+ A
Sbjct: 136 FDVFLRPYFTDAYRPVHKGDIFTVQAA 162



 Score =  104 bits (250), Expect = 5e-23
 Identities = 47/56 (83%), Positives = 51/56 (91%)
 Frame = +1

Query: 514 MRAVEFKVVETDPSPFCIVAPDTVIHCDGEPIKREEEEEALNAVGYDDIGGCRKQL 681
           MR VEFKVVETDP+P CIVAPDTVIH +G+PIKREEEEEALN VGYDD+GG RKQL
Sbjct: 163 MRTVEFKVVETDPAPACIVAPDTVIHYEGDPIKREEEEEALNEVGYDDLGGVRKQL 218



 Score = 89.8 bits (213), Expect = 2e-18
 Identities = 41/64 (64%), Positives = 56/64 (87%)
 Frame = +3

Query: 63  KSPDDLSTAILRRKDRPNRLIVEEAVSDDNSVVALSQAKMEQLQLFRGDTVLLKGKRRKE 242
           K  D+L+TAIL+ K RPNRLI++++ +DDNS+V LSQAKM++L LFRGD+V+LKGK+R+E
Sbjct: 13  KKNDELATAILKDKKRPNRLIIDQSDNDDNSMVMLSQAKMDELGLFRGDSVILKGKKRRE 72

Query: 243 TVCI 254
           TV I
Sbjct: 73  TVSI 76


>Z69904-3|CAA93780.1|  372|Caenorhabditis elegans Hypothetical
           protein ZK20.3 protein.
          Length = 372

 Score = 28.7 bits (61), Expect = 4.1
 Identities = 13/39 (33%), Positives = 22/39 (56%), Gaps = 2/39 (5%)
 Frame = +1

Query: 544 TDPSPFCIVAPDTVIHCDGEPIKREEEEE--ALNAVGYD 654
           ++P+P   VAP+     + E +  E+EE   A+  +GYD
Sbjct: 153 SNPAPAADVAPEAAAPAEAEALTDEQEENVLAITGMGYD 191


>AF125450-3|AAD12817.1|  309|Caenorhabditis elegans Hypothetical
          protein Y39F10A.3 protein.
          Length = 309

 Score = 28.7 bits (61), Expect = 4.1
 Identities = 11/25 (44%), Positives = 18/25 (72%)
 Frame = -2

Query: 77 IIRAFIICHFIQNLLLESKNYYNFY 3
          ++ AF++C  + N+LL SK+ Y FY
Sbjct: 8  LLLAFVVCLTLFNVLLWSKSNYGFY 32


>Z83217-5|CAB05684.2| 1565|Caenorhabditis elegans Hypothetical
           protein C10C6.1 protein.
          Length = 1565

 Score = 28.3 bits (60), Expect = 5.5
 Identities = 22/70 (31%), Positives = 30/70 (42%), Gaps = 1/70 (1%)
 Frame = +1

Query: 52  WQIIKALMIYRPRSSVARTDPTVSLSKKQSAMT-TQSWHFHRPKWSNFNSSVVTQSCSRA 228
           W       + R RSS+  +DP +S S   S  T T S H      +   SS  T S +R+
Sbjct: 56  WTSASMTNLCRVRSSLGHSDPQLSSSSTNSFNTSTSSLHPATKSSTTALSSFSTSSANRS 115

Query: 229 NAARKPFASA 258
            A R    S+
Sbjct: 116 PANRPSLHSS 125


>AM086627-1|CAJ31105.1| 1565|Caenorhabditis elegans KIN-4 protein
           protein.
          Length = 1565

 Score = 28.3 bits (60), Expect = 5.5
 Identities = 22/70 (31%), Positives = 30/70 (42%), Gaps = 1/70 (1%)
 Frame = +1

Query: 52  WQIIKALMIYRPRSSVARTDPTVSLSKKQSAMT-TQSWHFHRPKWSNFNSSVVTQSCSRA 228
           W       + R RSS+  +DP +S S   S  T T S H      +   SS  T S +R+
Sbjct: 56  WTSASMTNLCRVRSSLGHSDPQLSSSSTNSFNTSTSSLHPATKSSTTALSSFSTSSANRS 115

Query: 229 NAARKPFASA 258
            A R    S+
Sbjct: 116 PANRPSLHSS 125


>Z66562-5|CAA91466.1|  250|Caenorhabditis elegans Hypothetical
           protein F42E11.4 protein.
          Length = 250

 Score = 27.9 bits (59), Expect = 7.2
 Identities = 15/50 (30%), Positives = 26/50 (52%)
 Frame = +3

Query: 42  LNKMADNKSPDDLSTAILRRKDRPNRLIVEEAVSDDNSVVALSQAKMEQL 191
           L K+  NK+ +DL T  LR++    +++ E  V+  N       AK+E +
Sbjct: 61  LRKLLMNKAAEDLKTQQLRKEQERVKVLAERTVALPNVDSIDDHAKLEAI 110


>AB107358-1|BAD89379.1|  250|Caenorhabditis elegans troponin I 1
           protein.
          Length = 250

 Score = 27.9 bits (59), Expect = 7.2
 Identities = 15/50 (30%), Positives = 26/50 (52%)
 Frame = +3

Query: 42  LNKMADNKSPDDLSTAILRRKDRPNRLIVEEAVSDDNSVVALSQAKMEQL 191
           L K+  NK+ +DL T  LR++    +++ E  V+  N       AK+E +
Sbjct: 61  LRKLLMNKAAEDLKTQQLRKEQERVKVLAERTVALPNVDSIDDHAKLEAI 110


>U23172-6|AAV58869.1|  484|Caenorhabditis elegans Hypothetical
           protein F25B5.6c protein.
          Length = 484

 Score = 27.5 bits (58), Expect = 9.6
 Identities = 9/16 (56%), Positives = 12/16 (75%)
 Frame = -1

Query: 528 LDGAHAPRTMKVSSRW 481
           LDGAH P++M+  S W
Sbjct: 330 LDGAHTPKSMEACSEW 345


>U23172-5|AAC46527.1|  510|Caenorhabditis elegans Hypothetical
           protein F25B5.6a protein.
          Length = 510

 Score = 27.5 bits (58), Expect = 9.6
 Identities = 9/16 (56%), Positives = 12/16 (75%)
 Frame = -1

Query: 528 LDGAHAPRTMKVSSRW 481
           LDGAH P++M+  S W
Sbjct: 356 LDGAHTPKSMEACSEW 371


>U23172-4|AAL02494.1|  521|Caenorhabditis elegans Hypothetical
           protein F25B5.6b protein.
          Length = 521

 Score = 27.5 bits (58), Expect = 9.6
 Identities = 9/16 (56%), Positives = 12/16 (75%)
 Frame = -1

Query: 528 LDGAHAPRTMKVSSRW 481
           LDGAH P++M+  S W
Sbjct: 367 LDGAHTPKSMEACSEW 382


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 16,188,855
Number of Sequences: 27780
Number of extensions: 344799
Number of successful extensions: 948
Number of sequences better than 10.0: 12
Number of HSP's better than 10.0 without gapping: 883
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 946
length of database: 12,740,198
effective HSP length: 79
effective length of database: 10,545,578
effective search space used: 1581836700
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -