SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30114.Seq
         (672 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U41542-6|AAK39152.1|  493|Caenorhabditis elegans Protein disulfi...   111   4e-25
U41542-8|AAN39682.1|  437|Caenorhabditis elegans Protein disulfi...    99   3e-21
U41542-7|ABO16445.1|  371|Caenorhabditis elegans Protein disulfi...    98   4e-21
Z37139-1|CAA85491.1|  485|Caenorhabditis elegans Hypothetical pr...    94   7e-20
U95074-1|AAB94647.1|  485|Caenorhabditis elegans protein disulph...    94   7e-20
Z92970-1|CAB07480.1|  488|Caenorhabditis elegans Hypothetical pr...    76   2e-14
AB072567-1|BAB88817.1|  488|Caenorhabditis elegans ceERp57 protein.    76   2e-14
L15188-9|AAM22024.1|  618|Caenorhabditis elegans Hypothetical pr...    76   3e-14
U40411-4|AAC47065.1|  440|Caenorhabditis elegans Temporarily ass...    66   3e-11
AC006834-9|AAL11490.1|  447|Caenorhabditis elegans Hypothetical ...    61   8e-10
Z98866-5|CAB11548.1|  436|Caenorhabditis elegans Hypothetical pr...    57   1e-08
AC084197-8|AAG23476.1|  228|Caenorhabditis elegans Hypothetical ...    48   5e-06
AL032657-16|CAJ85780.1|  318|Caenorhabditis elegans Hypothetical...    48   6e-06
AL032657-15|CAA21734.1|  788|Caenorhabditis elegans Hypothetical...    48   6e-06
Z69637-1|CAA93467.1|  601|Caenorhabditis elegans Hypothetical pr...    46   2e-05
U97402-2|AAB63409.2|  393|Caenorhabditis elegans Hypothetical pr...    46   3e-05
U97402-1|ABB51193.1|  393|Caenorhabditis elegans Hypothetical pr...    46   3e-05
U80848-2|AAB37989.1|  574|Caenorhabditis elegans Hypothetical pr...    45   6e-05
U23168-6|AAP86623.1|  114|Caenorhabditis elegans Hypothetical pr...    43   2e-04
DQ241300-1|ABB45864.1|  114|Caenorhabditis elegans TRX-1b protein.     43   2e-04
U23168-7|AAC38808.1|  115|Caenorhabditis elegans Hypothetical pr...    41   7e-04
DQ241299-1|ABB45863.1|  115|Caenorhabditis elegans TRX-1a protein.     41   7e-04
Z69792-2|CAA93667.1|  417|Caenorhabditis elegans Hypothetical pr...    40   0.002
U41012-4|AAA82296.2|  413|Caenorhabditis elegans Hypothetical pr...    40   0.002
U39646-7|AAA80371.1|  623|Caenorhabditis elegans Hypothetical pr...    37   0.011
U39646-6|AAK72058.1|  624|Caenorhabditis elegans Hypothetical pr...    37   0.011
U39646-5|AAK72057.1|  678|Caenorhabditis elegans Hypothetical pr...    37   0.011
Z71178-7|CAA94881.1|  119|Caenorhabditis elegans Hypothetical pr...    35   0.061
AF250045-1|AAG17620.1|  246|Caenorhabditis elegans thioredoxin-l...    35   0.061
AF125955-2|AAD14719.1|  246|Caenorhabditis elegans Dumpy : short...    35   0.061
U88167-3|AAB42224.2|  363|Caenorhabditis elegans Hypothetical pr...    34   0.11 
AL110477-15|CAB54331.2|  295|Caenorhabditis elegans Hypothetical...    34   0.11 
AF143900-1|AAF66677.1|  284|Caenorhabditis elegans thioredoxin-l...    32   0.43 
AF143405-1|AAF66636.1|  284|Caenorhabditis elegans thioredoxin-l...    32   0.43 
AC024810-17|AAF60759.1|  284|Caenorhabditis elegans Hypothetical...    32   0.43 
Z81044-3|CAB02808.1|  178|Caenorhabditis elegans Hypothetical pr...    31   0.56 
Z81552-7|CAB04487.2|  606|Caenorhabditis elegans Hypothetical pr...    31   0.99 
AL117201-5|CAB57916.1|  606|Caenorhabditis elegans Hypothetical ...    31   0.99 
AC024827-2|AAF60805.2|  254|Caenorhabditis elegans Hypothetical ...    30   1.3  
AF016415-9|AAW88416.1|  297|Caenorhabditis elegans Serpentine re...    30   1.7  
Z70780-8|CAA94825.2|  266|Caenorhabditis elegans Hypothetical pr...    28   5.3  
U70853-9|AAB09142.2|  158|Caenorhabditis elegans Hypothetical pr...    28   5.3  
AF106589-2|AAC78230.1|  107|Caenorhabditis elegans Hypothetical ...    28   5.3  
U39666-1|AAA80412.2|  644|Caenorhabditis elegans Nematode astaci...    28   6.9  
AJ561221-1|CAD99221.1|  302|Caenorhabditis elegans NAS-33 protei...    28   6.9  
U80443-6|AAK68201.1|  643|Caenorhabditis elegans Ferm domain (pr...    27   9.2  
U80443-5|AAD32269.1|  635|Caenorhabditis elegans Ferm domain (pr...    27   9.2  
U66261-1|AAB07022.1| 1525|Caenorhabditis elegans multidrug resis...    27   9.2  
U41554-4|AAA83299.2| 1525|Caenorhabditis elegans Multidrug resis...    27   9.2  

>U41542-6|AAK39152.1|  493|Caenorhabditis elegans Protein disulfide
           isomerase protein2, isoform a protein.
          Length = 493

 Score =  111 bits (267), Expect = 4e-25
 Identities = 55/134 (41%), Positives = 78/134 (58%)
 Frame = +1

Query: 253 QLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAVEV 432
           +L K+DAT   +++  + VRGYPTLK FRNG P +Y+GGR  D II+WLKKKTGP A  +
Sbjct: 77  KLGKLDATVHGEVSSKFEVRGYPTLKLFRNGKPQEYNGGRDHDSIIAWLKKKTGPVAKPL 136

Query: 433 TSAEQAKELIDANTVIVFGFFSDQS*PEPKLSFQXXXXXXXXXXXXSAMRK*FKELEAED 612
             A+  KEL ++  V+V G+F D +  + K   +            S       E+E + 
Sbjct: 137 ADADAVKELQESADVVVIGYFKDTTSDDAKTFLEVAAGIDDVPFGISTEDAVKSEIELKG 196

Query: 613 EDVVLFKNFEEKRV 654
           E +VLFK F++ RV
Sbjct: 197 EGIVLFKKFDDGRV 210



 Score = 97.5 bits (232), Expect = 8e-21
 Identities = 49/81 (60%), Positives = 57/81 (70%), Gaps = 3/81 (3%)
 Frame = +2

Query: 35  IFTAIALLGLALGDE---VPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAP 205
           +F  + L  L LG     +  EENV+VL+K NF+ VI   E+ILVEFYAPWCGHCKSLAP
Sbjct: 1   MFRLVGLFFLVLGASAAVIEEEENVIVLTKDNFDEVINGNEFILVEFYAPWCGHCKSLAP 60

Query: 206 EYAKAATKLAEEESPIN*RKL 268
           EYAKAAT+L EE S I   KL
Sbjct: 61  EYAKAATQLKEEGSDIKLGKL 81



 Score = 61.3 bits (142), Expect = 6e-10
 Identities = 28/51 (54%), Positives = 34/51 (66%), Gaps = 1/51 (1%)
 Frame = +2

Query: 98  VLVLSKANFETVIT-TTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEES 247
           V +L   NFE V    T+ +LVEFYAPWCGHCK LAP + K   K A++ES
Sbjct: 365 VKILVGKNFEQVARDNTKNVLVEFYAPWCGHCKQLAPTWDKLGEKFADDES 415



 Score = 37.1 bits (82), Expect = 0.011
 Identities = 24/71 (33%), Positives = 38/71 (53%), Gaps = 4/71 (5%)
 Frame = +1

Query: 247 SYQLAKVDATQEQDLAESYGVRGYPTLKFFRNGS--PIDYSGGRQADDIISWLKK--KTG 414
           S  +AK+D+T  +   E   ++ +PT+KFF  GS   +DY+G R  +    +L+   K G
Sbjct: 415 SIVIAKMDSTLNE--VEDVKIQSFPTIKFFPAGSNKVVDYTGDRTIEGFTKFLETNGKEG 472

Query: 415 PPAVEVTSAEQ 447
             A E   AE+
Sbjct: 473 AGASEEEKAEE 483


>U41542-8|AAN39682.1|  437|Caenorhabditis elegans Protein disulfide
           isomerase protein2, isoform b protein.
          Length = 437

 Score = 98.7 bits (235), Expect = 3e-21
 Identities = 45/94 (47%), Positives = 62/94 (65%)
 Frame = +1

Query: 253 QLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAVEV 432
           +L K+DAT   +++  + VRGYPTLK FRNG P +Y+GGR  D II+WLKKKTGP A  +
Sbjct: 77  KLGKLDATVHGEVSSKFEVRGYPTLKLFRNGKPQEYNGGRDHDSIIAWLKKKTGPVAKPL 136

Query: 433 TSAEQAKELIDANTVIVFGFFSDQS*PEPKLSFQ 534
             A+  KEL ++  V+V G+F D +  + K   Q
Sbjct: 137 ADADAVKELQESADVVVIGYFKDTTSDDAKTWIQ 170



 Score = 97.5 bits (232), Expect = 8e-21
 Identities = 49/81 (60%), Positives = 57/81 (70%), Gaps = 3/81 (3%)
 Frame = +2

Query: 35  IFTAIALLGLALGDE---VPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAP 205
           +F  + L  L LG     +  EENV+VL+K NF+ VI   E+ILVEFYAPWCGHCKSLAP
Sbjct: 1   MFRLVGLFFLVLGASAAVIEEEENVIVLTKDNFDEVINGNEFILVEFYAPWCGHCKSLAP 60

Query: 206 EYAKAATKLAEEESPIN*RKL 268
           EYAKAAT+L EE S I   KL
Sbjct: 61  EYAKAATQLKEEGSDIKLGKL 81



 Score = 61.3 bits (142), Expect = 6e-10
 Identities = 28/51 (54%), Positives = 34/51 (66%), Gaps = 1/51 (1%)
 Frame = +2

Query: 98  VLVLSKANFETVIT-TTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEES 247
           V +L   NFE V    T+ +LVEFYAPWCGHCK LAP + K   K A++ES
Sbjct: 309 VKILVGKNFEQVARDNTKNVLVEFYAPWCGHCKQLAPTWDKLGEKFADDES 359



 Score = 37.1 bits (82), Expect = 0.011
 Identities = 24/71 (33%), Positives = 38/71 (53%), Gaps = 4/71 (5%)
 Frame = +1

Query: 247 SYQLAKVDATQEQDLAESYGVRGYPTLKFFRNGS--PIDYSGGRQADDIISWLKK--KTG 414
           S  +AK+D+T  +   E   ++ +PT+KFF  GS   +DY+G R  +    +L+   K G
Sbjct: 359 SIVIAKMDSTLNE--VEDVKIQSFPTIKFFPAGSNKVVDYTGDRTIEGFTKFLETNGKEG 416

Query: 415 PPAVEVTSAEQ 447
             A E   AE+
Sbjct: 417 AGASEEEKAEE 427


>U41542-7|ABO16445.1|  371|Caenorhabditis elegans Protein disulfide
           isomerase protein2, isoform c protein.
          Length = 371

 Score = 98.3 bits (234), Expect = 4e-21
 Identities = 44/90 (48%), Positives = 61/90 (67%)
 Frame = +1

Query: 253 QLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAVEV 432
           +L K+DAT   +++  + VRGYPTLK FRNG P +Y+GGR  D II+WLKKKTGP A  +
Sbjct: 77  KLGKLDATVHGEVSSKFEVRGYPTLKLFRNGKPQEYNGGRDHDSIIAWLKKKTGPVAKPL 136

Query: 433 TSAEQAKELIDANTVIVFGFFSDQS*PEPK 522
             A+  KEL ++  V+V G+F D +  + K
Sbjct: 137 ADADAVKELQESADVVVIGYFKDTTSDDAK 166



 Score = 97.5 bits (232), Expect = 8e-21
 Identities = 49/81 (60%), Positives = 57/81 (70%), Gaps = 3/81 (3%)
 Frame = +2

Query: 35  IFTAIALLGLALGDE---VPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAP 205
           +F  + L  L LG     +  EENV+VL+K NF+ VI   E+ILVEFYAPWCGHCKSLAP
Sbjct: 1   MFRLVGLFFLVLGASAAVIEEEENVIVLTKDNFDEVINGNEFILVEFYAPWCGHCKSLAP 60

Query: 206 EYAKAATKLAEEESPIN*RKL 268
           EYAKAAT+L EE S I   KL
Sbjct: 61  EYAKAATQLKEEGSDIKLGKL 81



 Score = 61.3 bits (142), Expect = 6e-10
 Identities = 28/51 (54%), Positives = 34/51 (66%), Gaps = 1/51 (1%)
 Frame = +2

Query: 98  VLVLSKANFETVIT-TTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEES 247
           V +L   NFE V    T+ +LVEFYAPWCGHCK LAP + K   K A++ES
Sbjct: 243 VKILVGKNFEQVARDNTKNVLVEFYAPWCGHCKQLAPTWDKLGEKFADDES 293



 Score = 37.1 bits (82), Expect = 0.011
 Identities = 24/71 (33%), Positives = 38/71 (53%), Gaps = 4/71 (5%)
 Frame = +1

Query: 247 SYQLAKVDATQEQDLAESYGVRGYPTLKFFRNGS--PIDYSGGRQADDIISWLKK--KTG 414
           S  +AK+D+T  +   E   ++ +PT+KFF  GS   +DY+G R  +    +L+   K G
Sbjct: 293 SIVIAKMDSTLNE--VEDVKIQSFPTIKFFPAGSNKVVDYTGDRTIEGFTKFLETNGKEG 350

Query: 415 PPAVEVTSAEQ 447
             A E   AE+
Sbjct: 351 AGASEEEKAEE 361


>Z37139-1|CAA85491.1|  485|Caenorhabditis elegans Hypothetical
           protein C14B1.1 protein.
          Length = 485

 Score = 94.3 bits (224), Expect = 7e-20
 Identities = 41/83 (49%), Positives = 55/83 (66%)
 Frame = +1

Query: 253 QLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAVEV 432
           +LAKVDAT+ Q LA  + VRGYPT+ +F++G P  Y+GGR    I+ W+KKK+GP    V
Sbjct: 77  KLAKVDATENQALASKFEVRGYPTILYFKSGKPTKYTGGRATAQIVDWVKKKSGPTVTTV 136

Query: 433 TSAEQAKELIDANTVIVFGFFSD 501
            S EQ +EL     V+V G+F D
Sbjct: 137 ESVEQLEELKGKTRVVVLGYFKD 159



 Score = 84.2 bits (199), Expect = 8e-17
 Identities = 41/80 (51%), Positives = 54/80 (67%)
 Frame = +2

Query: 47  IALLGLALGDEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAAT 226
           I LL  ++G  V   ENVLVL+++NFE  I   E++LV+FYAPWC HCKSLAP+Y +AA 
Sbjct: 8   IFLLVASIGAVVADSENVLVLTESNFEETINGNEFVLVKFYAPWCVHCKSLAPKYDEAAD 67

Query: 227 KLAEEESPIN*RKLTQLKNR 286
            L EE S I   K+   +N+
Sbjct: 68  LLKEEGSDIKLAKVDATENQ 87



 Score = 50.4 bits (115), Expect = 1e-06
 Identities = 24/55 (43%), Positives = 34/55 (61%), Gaps = 4/55 (7%)
 Frame = +2

Query: 77  EVPTEENVL---VLSKANF-ETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATK 229
           ++P + N L   VL  +NF E  +  T+ + V+FYAPWCGHCK L P + + A K
Sbjct: 355 DLPEDWNALPVKVLVASNFNEIALDETKTVFVKFYAPWCGHCKQLVPVWDELAEK 409



 Score = 39.1 bits (87), Expect = 0.003
 Identities = 24/70 (34%), Positives = 39/70 (55%), Gaps = 2/70 (2%)
 Frame = +1

Query: 256 LAKVDATQEQDLAESYGVRGYPTLKFFRNGS--PIDYSGGRQADDIISWLKKKTGPPAVE 429
           +AK+DAT  + LA+   V  +PTLK +  GS  P+DY G R  +    ++ K  G  +  
Sbjct: 418 IAKLDATLNE-LAD-VKVNSFPTLKLWPAGSSTPVDYDGDRNLEKFEEFVNKYAGSASES 475

Query: 430 VTSAEQAKEL 459
            T+++  +EL
Sbjct: 476 ETASQDHEEL 485


>U95074-1|AAB94647.1|  485|Caenorhabditis elegans protein disulphide
           isomerase isoformI protein.
          Length = 485

 Score = 94.3 bits (224), Expect = 7e-20
 Identities = 41/83 (49%), Positives = 55/83 (66%)
 Frame = +1

Query: 253 QLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAVEV 432
           +LAKVDAT+ Q LA  + VRGYPT+ +F++G P  Y+GGR    I+ W+KKK+GP    V
Sbjct: 77  KLAKVDATENQALASKFEVRGYPTILYFKSGKPTKYTGGRATAQIVDWVKKKSGPTVTTV 136

Query: 433 TSAEQAKELIDANTVIVFGFFSD 501
            S EQ +EL     V+V G+F D
Sbjct: 137 ESVEQLEELKGKTRVVVLGYFKD 159



 Score = 84.2 bits (199), Expect = 8e-17
 Identities = 41/80 (51%), Positives = 54/80 (67%)
 Frame = +2

Query: 47  IALLGLALGDEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAAT 226
           I LL  ++G  V   ENVLVL+++NFE  I   E++LV+FYAPWC HCKSLAP+Y +AA 
Sbjct: 8   IFLLVASIGAVVADSENVLVLTESNFEETINGNEFVLVKFYAPWCVHCKSLAPKYDEAAD 67

Query: 227 KLAEEESPIN*RKLTQLKNR 286
            L EE S I   K+   +N+
Sbjct: 68  LLKEEGSDIKLAKVDATENQ 87



 Score = 50.4 bits (115), Expect = 1e-06
 Identities = 24/55 (43%), Positives = 34/55 (61%), Gaps = 4/55 (7%)
 Frame = +2

Query: 77  EVPTEENVL---VLSKANF-ETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATK 229
           ++P + N L   VL  +NF E  +  T+ + V+FYAPWCGHCK L P + + A K
Sbjct: 355 DLPEDWNALPVKVLVASNFNEIALDETKTVFVKFYAPWCGHCKQLVPVWDELAEK 409



 Score = 39.1 bits (87), Expect = 0.003
 Identities = 24/70 (34%), Positives = 39/70 (55%), Gaps = 2/70 (2%)
 Frame = +1

Query: 256 LAKVDATQEQDLAESYGVRGYPTLKFFRNGS--PIDYSGGRQADDIISWLKKKTGPPAVE 429
           +AK+DAT  + LA+   V  +PTLK +  GS  P+DY G R  +    ++ K  G  +  
Sbjct: 418 IAKLDATLNE-LAD-VKVNSFPTLKLWPAGSSTPVDYDGDRNLEKFEEFVNKYAGSASES 475

Query: 430 VTSAEQAKEL 459
            T+++  +EL
Sbjct: 476 ETASQDHEEL 485


>Z92970-1|CAB07480.1|  488|Caenorhabditis elegans Hypothetical
           protein H06O01.1 protein.
          Length = 488

 Score = 76.2 bits (179), Expect = 2e-14
 Identities = 33/85 (38%), Positives = 54/85 (63%), Gaps = 1/85 (1%)
 Frame = +1

Query: 256 LAKVDATQEQDLAESYGVRGYPTLKFFRNGSPI-DYSGGRQADDIISWLKKKTGPPAVEV 432
           L KVD T E+ + + +GV+G+PTLK FRNG P  DY G R AD I+ +++ ++GP + E+
Sbjct: 75  LVKVDCTTEKTVCDKFGVKGFPTLKIFRNGVPAQDYDGPRDADGIVKFMRGQSGPSSKEL 134

Query: 433 TSAEQAKELIDANTVIVFGFFSDQS 507
            +  + ++    +  +V GFF  +S
Sbjct: 135 KTVAEFEKFTGGDENVVIGFFESES 159



 Score = 69.7 bits (163), Expect = 2e-12
 Identities = 28/52 (53%), Positives = 37/52 (71%)
 Frame = +2

Query: 98  VLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEESPI 253
           VL  +  NF+ +I T +  LV+FYAPWCGHCK +APEY +AA KLA  + P+
Sbjct: 22  VLEYTDGNFDDLIQTHDIALVKFYAPWCGHCKKIAPEYERAAPKLASNDPPV 73



 Score = 62.1 bits (144), Expect = 3e-10
 Identities = 32/76 (42%), Positives = 47/76 (61%), Gaps = 2/76 (2%)
 Frame = +2

Query: 74  DEVPTEE-NVLVLSKANF-ETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEES 247
           + +P E+ +V V    NF E ++   + +L+EFYAPWCGHCKSLAP+Y + A KL +E+ 
Sbjct: 355 EPIPDEQGDVKVAVGKNFKELIMDADKDVLIEFYAPWCGHCKSLAPKYEELAEKLNKEDV 414

Query: 248 PIN*RKLTQLKNRISP 295
            I   K+    N + P
Sbjct: 415 II--AKMDATANDVPP 428



 Score = 41.9 bits (94), Expect = 4e-04
 Identities = 21/53 (39%), Positives = 33/53 (62%), Gaps = 3/53 (5%)
 Frame = +1

Query: 256 LAKVDATQEQDLAESYGVRGYPTLKFF---RNGSPIDYSGGRQADDIISWLKK 405
           +AK+DAT   D+   + VRG+PTL +       +PI Y+GGR+  D +S++ K
Sbjct: 416 IAKMDATAN-DVPPMFEVRGFPTLFWLPKNAKSNPIPYNGGREVKDFVSFISK 467


>AB072567-1|BAB88817.1|  488|Caenorhabditis elegans ceERp57 protein.
          Length = 488

 Score = 76.2 bits (179), Expect = 2e-14
 Identities = 33/85 (38%), Positives = 54/85 (63%), Gaps = 1/85 (1%)
 Frame = +1

Query: 256 LAKVDATQEQDLAESYGVRGYPTLKFFRNGSPI-DYSGGRQADDIISWLKKKTGPPAVEV 432
           L KVD T E+ + + +GV+G+PTLK FRNG P  DY G R AD I+ +++ ++GP + E+
Sbjct: 75  LVKVDCTTEKTVCDKFGVKGFPTLKIFRNGVPAQDYDGPRDADGIVKFMRGQSGPSSKEL 134

Query: 433 TSAEQAKELIDANTVIVFGFFSDQS 507
            +  + ++    +  +V GFF  +S
Sbjct: 135 KTVAEFEKFTGGDENVVIGFFESES 159



 Score = 69.7 bits (163), Expect = 2e-12
 Identities = 28/52 (53%), Positives = 37/52 (71%)
 Frame = +2

Query: 98  VLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEESPI 253
           VL  +  NF+ +I T +  LV+FYAPWCGHCK +APEY +AA KLA  + P+
Sbjct: 22  VLEYTDGNFDDLIQTHDIALVKFYAPWCGHCKKIAPEYERAAPKLASNDPPV 73



 Score = 62.1 bits (144), Expect = 3e-10
 Identities = 32/76 (42%), Positives = 47/76 (61%), Gaps = 2/76 (2%)
 Frame = +2

Query: 74  DEVPTEE-NVLVLSKANF-ETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEES 247
           + +P E+ +V V    NF E ++   + +L+EFYAPWCGHCKSLAP+Y + A KL +E+ 
Sbjct: 355 EPIPDEQGDVKVAVGKNFKELIMDADKDVLIEFYAPWCGHCKSLAPKYEELAEKLNKEDV 414

Query: 248 PIN*RKLTQLKNRISP 295
            I   K+    N + P
Sbjct: 415 II--AKMDATANDVPP 428



 Score = 41.9 bits (94), Expect = 4e-04
 Identities = 21/53 (39%), Positives = 33/53 (62%), Gaps = 3/53 (5%)
 Frame = +1

Query: 256 LAKVDATQEQDLAESYGVRGYPTLKFF---RNGSPIDYSGGRQADDIISWLKK 405
           +AK+DAT   D+   + VRG+PTL +       +PI Y+GGR+  D +S++ K
Sbjct: 416 IAKMDATAN-DVPPMFEVRGFPTLFWLPKNAKSNPIPYNGGREVKDFVSFISK 467


>L15188-9|AAM22024.1|  618|Caenorhabditis elegans Hypothetical
           protein C14B9.2 protein.
          Length = 618

 Score = 75.8 bits (178), Expect = 3e-14
 Identities = 32/57 (56%), Positives = 39/57 (68%)
 Frame = +2

Query: 83  PTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEESPI 253
           P  E V+ L+  NF+  I+  E +LVEFYAPWCGHCK LAPEY KAA KL  + S +
Sbjct: 144 PPPEEVVTLTTENFDDFISNNELVLVEFYAPWCGHCKKLAPEYEKAAQKLKAQGSKV 200



 Score = 74.5 bits (175), Expect = 6e-14
 Identities = 33/84 (39%), Positives = 51/84 (60%)
 Frame = +1

Query: 253 QLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAVEV 432
           +L KVDAT E+DL   YGV GYPT+K  RNG   DY+G R+A  II ++  ++ P A ++
Sbjct: 201 KLGKVDATIEKDLGTKYGVSGYPTMKIIRNGRRFDYNGPREAAGIIKYMTDQSKPAAKKL 260

Query: 433 TSAEQAKELIDANTVIVFGFFSDQ 504
              +  +  +  + V + GFF+ +
Sbjct: 261 PKLKDVERFMSKDDVTIIGFFATE 284



 Score = 67.3 bits (157), Expect = 9e-12
 Identities = 29/66 (43%), Positives = 44/66 (66%)
 Frame = +2

Query: 89  EENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEESPIN*RKL 268
           +E V+VL+  NF+  +     +LV+FYAPWCGHCK LAPEY KA++K++   + ++    
Sbjct: 35  DEGVVVLTDKNFDAFLKKNPSVLVKFYAPWCGHCKHLAPEYEKASSKVSIPLAKVDATVE 94

Query: 269 TQLKNR 286
           T+L  R
Sbjct: 95  TELGKR 100



 Score = 66.9 bits (156), Expect = 1e-11
 Identities = 34/93 (36%), Positives = 55/93 (59%), Gaps = 7/93 (7%)
 Frame = +1

Query: 241 RISYQLAKVDATQEQDLAESYGVRGYPTLKFFRNG-SPIDYSGGRQADDIISWLKKKTG- 414
           ++S  LAKVDAT E +L + + ++GYPTLKF+++G  P DY GGR    I+ W++ +   
Sbjct: 81  KVSIPLAKVDATVETELGKRFEIQGYPTLKFWKDGKGPNDYDGGRDEAGIVEWVESRVDP 140

Query: 415 ---PPAVEVT--SAEQAKELIDANTVIVFGFFS 498
              PP  EV   + E   + I  N +++  F++
Sbjct: 141 NYKPPPEEVVTLTTENFDDFISNNELVLVEFYA 173



 Score = 48.8 bits (111), Expect = 3e-06
 Identities = 18/44 (40%), Positives = 30/44 (68%), Gaps = 1/44 (2%)
 Frame = +2

Query: 116 ANFETVITT-TEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEE 244
           +NF+ ++   ++ +L+EFYAPWCGHCKS   +Y + A  L + +
Sbjct: 507 SNFDKIVNDESKDVLIEFYAPWCGHCKSFESKYVELAQALKKTQ 550


>U40411-4|AAC47065.1|  440|Caenorhabditis elegans Temporarily
           assigned gene nameprotein 320 protein.
          Length = 440

 Score = 65.7 bits (153), Expect = 3e-11
 Identities = 28/49 (57%), Positives = 40/49 (81%), Gaps = 1/49 (2%)
 Frame = +2

Query: 89  EENVLVLSKANFET-VITTTEYILVEFYAPWCGHCKSLAPEYAKAATKL 232
           +++V+ L++ANF++ VI + +  +VEFYAPWCGHCKSL PEY KAA+ L
Sbjct: 23  KDDVVELTEANFQSKVINSDDIWIVEFYAPWCGHCKSLVPEYKKAASAL 71



 Score = 57.6 bits (133), Expect = 8e-09
 Identities = 25/46 (54%), Positives = 36/46 (78%), Gaps = 1/46 (2%)
 Frame = +2

Query: 98  VLVLSKANFETVITTTEYI-LVEFYAPWCGHCKSLAPEYAKAATKL 232
           V+ L+ ANFE ++  ++ I LVEF+APWCGHCKSL P++  AA++L
Sbjct: 166 VVELTDANFEDLVLNSKDIWLVEFFAPWCGHCKSLEPQWKAAASEL 211



 Score = 54.0 bits (124), Expect = 9e-08
 Identities = 28/78 (35%), Positives = 44/78 (56%), Gaps = 6/78 (7%)
 Frame = +1

Query: 253 QLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPI----DYSGGRQADDIISW--LKKKTG 414
           +L  +DAT    +A  + +RG+PT+K+F  GS +    DY GGRQ+ DI++W   + +  
Sbjct: 216 RLGALDATVHTVVANKFAIRGFPTIKYFAPGSDVSDAQDYDGGRQSSDIVAWASARAQEN 275

Query: 415 PPAVEVTSAEQAKELIDA 468
            PA EV      + + DA
Sbjct: 276 MPAPEVFEGINQQVVEDA 293



 Score = 39.5 bits (88), Expect = 0.002
 Identities = 20/47 (42%), Positives = 26/47 (55%), Gaps = 2/47 (4%)
 Frame = +1

Query: 253 QLAKVDATQEQDLAESYGVRGYPTLKFF--RNGSPIDYSGGRQADDI 387
           ++  VD TQ Q +   Y V+G+PTLK F      P DY+G R A  I
Sbjct: 76  KVGAVDMTQHQSVGGPYNVQGFPTLKIFGADKKKPTDYNGQRTAQAI 122


>AC006834-9|AAL11490.1|  447|Caenorhabditis elegans Hypothetical
           protein ZK973.11 protein.
          Length = 447

 Score = 60.9 bits (141), Expect = 8e-10
 Identities = 30/88 (34%), Positives = 52/88 (59%), Gaps = 1/88 (1%)
 Frame = +1

Query: 253 QLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAVEV 432
           ++ K+D T+   +A    ++GYPT+ FFRNG  IDY GGR+ + ++S+  K+   P +EV
Sbjct: 80  RVGKLDCTRFPAVANKLSIQGYPTILFFRNGHVIDYRGGREKEALVSF-AKRCAAPIIEV 138

Query: 433 TSAEQAKEL-IDANTVIVFGFFSDQS*P 513
            +  Q +++ + A +   + FF   S P
Sbjct: 139 INENQIEKVKLSARSQPSYVFFGTSSGP 166



 Score = 43.6 bits (98), Expect = 1e-04
 Identities = 18/37 (48%), Positives = 22/37 (59%)
 Frame = +2

Query: 158 VEFYAPWCGHCKSLAPEYAKAATKLAEEESPIN*RKL 268
           VEFYAPWC HCK L P + +    L++   PI   KL
Sbjct: 48  VEFYAPWCAHCKRLHPVWDQVGHTLSDSNLPIRVGKL 84


>Z98866-5|CAB11548.1|  436|Caenorhabditis elegans Hypothetical
           protein Y49E10.4 protein.
          Length = 436

 Score = 57.2 bits (132), Expect = 1e-08
 Identities = 25/49 (51%), Positives = 36/49 (73%), Gaps = 1/49 (2%)
 Frame = +2

Query: 89  EENVLVLSKANFETVITTTEYI-LVEFYAPWCGHCKSLAPEYAKAATKL 232
           +++V  L+ +NF+  +  ++ I +VEFYAP+CGHCKSL PEY KAA  L
Sbjct: 23  KDSVFELTDSNFDAKVLKSDRIWIVEFYAPYCGHCKSLVPEYKKAAKLL 71



 Score = 55.2 bits (127), Expect = 4e-08
 Identities = 23/46 (50%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query: 98  VLVLSKANFET-VITTTEYILVEFYAPWCGHCKSLAPEYAKAATKL 232
           V+VL+ +NF+  V+ + E  +VEF+APWCGHC+ L PE+ KAA ++
Sbjct: 156 VVVLTDSNFDKLVLNSKEPWMVEFFAPWCGHCQKLEPEWKKAAEEM 201



 Score = 52.0 bits (119), Expect = 4e-07
 Identities = 28/86 (32%), Positives = 45/86 (52%), Gaps = 10/86 (11%)
 Frame = +1

Query: 265 VDATQEQDLAESYGVRGYPTLKFFRNGSPI-----DYSGGRQADDIISWLKKK-----TG 414
           +DAT  + +A+ +G+RG+PT+KFF  G+       DY GGR + D+IS+ + K       
Sbjct: 210 LDATAHESIAQKFGIRGFPTIKFFAPGTSSASDAEDYQGGRTSTDLISYAESKYDDFGAA 269

Query: 415 PPAVEVTSAEQAKELIDANTVIVFGF 492
           P  VE T     + +     + +F F
Sbjct: 270 PEVVEGTGKAVVETVCKDKQLCIFTF 295



 Score = 46.4 bits (105), Expect = 2e-05
 Identities = 27/83 (32%), Positives = 44/83 (53%), Gaps = 6/83 (7%)
 Frame = +1

Query: 253 QLAKVDATQEQDLAESYGVRGYPTLKFF---RNGSPIDYSGGRQADDIISWLKK---KTG 414
           ++  +DAT  Q +   Y ++GYPT+K F       PIDY+G R A  I   +KK   K+ 
Sbjct: 76  EIGAIDATVHQKIPLKYSIKGYPTIKIFGATEKSKPIDYNGPRTAKGIADAVKKSIEKSL 135

Query: 415 PPAVEVTSAEQAKELIDANTVIV 483
              ++  S+E++K+      V+V
Sbjct: 136 EQRLKGKSSEKSKKSDKKGKVVV 158


>AC084197-8|AAG23476.1|  228|Caenorhabditis elegans Hypothetical
           protein Y73B6BL.12 protein.
          Length = 228

 Score = 48.4 bits (110), Expect = 5e-06
 Identities = 23/52 (44%), Positives = 33/52 (63%)
 Frame = +2

Query: 80  VPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLA 235
           +PTE  V+ L      TV+ ++E  +V+F+APWCGHC   AP Y + A +LA
Sbjct: 108 LPTE--VVSLGNDFHTTVLDSSEPWIVDFFAPWCGHCIQFAPIYDRIAKELA 157


>AL032657-16|CAJ85780.1|  318|Caenorhabditis elegans Hypothetical
           protein Y47H9C.5b protein.
          Length = 318

 Score = 48.0 bits (109), Expect = 6e-06
 Identities = 23/52 (44%), Positives = 33/52 (63%)
 Frame = +2

Query: 80  VPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLA 235
           +PTE  V+ L      TV+ ++E  +V+F+APWCGHC   AP Y + A +LA
Sbjct: 198 LPTE--VVSLGNDFHTTVLDSSEPWIVDFFAPWCGHCIQFAPIYDQIAKELA 247



 Score = 47.2 bits (107), Expect = 1e-05
 Identities = 22/50 (44%), Positives = 32/50 (64%), Gaps = 3/50 (6%)
 Frame = +2

Query: 95  NVLVLSKANFETVITTT---EYILVEFYAPWCGHCKSLAPEYAKAATKLA 235
           +V+ +S   FE ++      E  LV+F+APWCG C+ LAPE  KAA ++A
Sbjct: 80  SVMEMSPEQFEELVMNRKDEETWLVDFFAPWCGPCQQLAPELQKAARQIA 129


>AL032657-15|CAA21734.1|  788|Caenorhabditis elegans Hypothetical
           protein Y47H9C.5a protein.
          Length = 788

 Score = 48.0 bits (109), Expect = 6e-06
 Identities = 23/52 (44%), Positives = 33/52 (63%)
 Frame = +2

Query: 80  VPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLA 235
           +PTE  V+ L      TV+ ++E  +V+F+APWCGHC   AP Y + A +LA
Sbjct: 668 LPTE--VVSLGNDFHTTVLDSSEPWIVDFFAPWCGHCIQFAPIYDQIAKELA 717



 Score = 47.2 bits (107), Expect = 1e-05
 Identities = 22/50 (44%), Positives = 32/50 (64%), Gaps = 3/50 (6%)
 Frame = +2

Query: 95  NVLVLSKANFETVITTT---EYILVEFYAPWCGHCKSLAPEYAKAATKLA 235
           +V+ +S   FE ++      E  LV+F+APWCG C+ LAPE  KAA ++A
Sbjct: 550 SVMEMSPEQFEELVMNRKDEETWLVDFFAPWCGPCQQLAPELQKAARQIA 599



 Score = 42.7 bits (96), Expect = 2e-04
 Identities = 15/52 (28%), Positives = 33/52 (63%)
 Frame = +2

Query: 86  TEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEE 241
           ++ ++ VL++ ++E  I+  E+ +++++APWC  C  L  EY +  T  +E+
Sbjct: 436 SKSHIHVLNRDSYEYAISGGEFYIIDYFAPWCPPCMKLLGEYRRFHTATSED 487



 Score = 40.3 bits (90), Expect = 0.001
 Identities = 14/49 (28%), Positives = 32/49 (65%), Gaps = 1/49 (2%)
 Frame = +2

Query: 89  EENVLVLSKANFETVITTTEYI-LVEFYAPWCGHCKSLAPEYAKAATKL 232
           ++ ++ L++A+F+ +++ +  I  + FY+ +C HC  LAP + K A ++
Sbjct: 115 DQEIVTLNRADFQRMVSDSNEIWFINFYSTYCSHCHQLAPTWRKFAREI 163


>Z69637-1|CAA93467.1|  601|Caenorhabditis elegans Hypothetical
           protein F35G2.1a protein.
          Length = 601

 Score = 46.4 bits (105), Expect = 2e-05
 Identities = 18/52 (34%), Positives = 29/52 (55%)
 Frame = +2

Query: 83  PTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAE 238
           P  E ++ L +  F   + +    LVEFYA WCGHC++ AP + + A  + +
Sbjct: 48  PGFEPIMHLDQMTFNDTVFSDRAFLVEFYADWCGHCRAFAPYFRQFANMVRD 99


>U97402-2|AAB63409.2|  393|Caenorhabditis elegans Hypothetical
           protein C30H7.2a protein.
          Length = 393

 Score = 45.6 bits (103), Expect = 3e-05
 Identities = 33/93 (35%), Positives = 47/93 (50%), Gaps = 5/93 (5%)
 Frame = +1

Query: 259 AKVDATQEQDLAESYGVRGYPTLKFFRNGSPI--DYSGGRQADDIISWLKKK---TGPPA 423
           A VDA +  D+A  Y V  YPTLK FRNG     +Y   R  + +  ++ K+   T    
Sbjct: 74  ASVDADKNNDIATKYHVNKYPTLKLFRNGEAAKREYRSSRSVEALSEFINKQMEVTVKKF 133

Query: 424 VEVTSAEQAKELIDANTVIVFGFFSDQS*PEPK 522
           +E  +A QA    + NT I  G+F D++  E K
Sbjct: 134 IE-KNALQAAHNPEKNTFI--GYFHDENSVEYK 163



 Score = 39.9 bits (89), Expect = 0.002
 Identities = 17/47 (36%), Positives = 25/47 (53%)
 Frame = +2

Query: 98  VLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAE 238
           V+ L+  NFE  I   E + V FYA WC   + L P + +A+ K  +
Sbjct: 19  VVSLTSQNFEQTIQANELVFVNFYADWCRFSQMLKPIFLEASEKFKD 65


>U97402-1|ABB51193.1|  393|Caenorhabditis elegans Hypothetical
           protein C30H7.2b protein.
          Length = 393

 Score = 45.6 bits (103), Expect = 3e-05
 Identities = 33/93 (35%), Positives = 47/93 (50%), Gaps = 5/93 (5%)
 Frame = +1

Query: 259 AKVDATQEQDLAESYGVRGYPTLKFFRNGSPI--DYSGGRQADDIISWLKKK---TGPPA 423
           A VDA +  D+A  Y V  YPTLK FRNG     +Y   R  + +  ++ K+   T    
Sbjct: 74  ASVDADKNNDIATKYHVNKYPTLKLFRNGEAAKREYRSSRSVEALSEFINKQMEVTVKKF 133

Query: 424 VEVTSAEQAKELIDANTVIVFGFFSDQS*PEPK 522
           +E  +A QA    + NT I  G+F D++  E K
Sbjct: 134 IE-KNALQAAHNPEKNTFI--GYFHDENSVEYK 163



 Score = 39.9 bits (89), Expect = 0.002
 Identities = 17/47 (36%), Positives = 25/47 (53%)
 Frame = +2

Query: 98  VLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAE 238
           V+ L+  NFE  I   E + V FYA WC   + L P + +A+ K  +
Sbjct: 19  VVSLTSQNFEQTIQANELVFVNFYADWCRFSQMLKPIFLEASEKFKD 65


>U80848-2|AAB37989.1|  574|Caenorhabditis elegans Hypothetical
           protein T10H10.2 protein.
          Length = 574

 Score = 44.8 bits (101), Expect = 6e-05
 Identities = 21/49 (42%), Positives = 28/49 (57%), Gaps = 4/49 (8%)
 Frame = +2

Query: 89  EENVLVLSKANFETVITTTEY----ILVEFYAPWCGHCKSLAPEYAKAA 223
           E++VL L +A F   I   +      LVEFY+ WCGHC++ AP Y   A
Sbjct: 33  EDSVLQLDEATFNDTIFGAQSGAAGYLVEFYSDWCGHCRAFAPTYKNLA 81


>U23168-6|AAP86623.1|  114|Caenorhabditis elegans Hypothetical
           protein B0228.5b protein.
          Length = 114

 Score = 43.2 bits (97), Expect = 2e-04
 Identities = 21/50 (42%), Positives = 34/50 (68%), Gaps = 3/50 (6%)
 Frame = +2

Query: 86  TEENVLVLSK-ANFETVITT--TEYILVEFYAPWCGHCKSLAPEYAKAAT 226
           T+E +L L+  ++FE +I     + I+++FYA WCG CK++AP Y + AT
Sbjct: 4   TKEPILELADMSDFEQLIRQHPEKIIILDFYATWCGPCKAIAPLYKELAT 53



 Score = 32.7 bits (71), Expect = 0.24
 Identities = 15/42 (35%), Positives = 22/42 (52%)
 Frame = +1

Query: 262 KVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDI 387
           KVD  + +DL   Y V+  PT  F +NG  I+   G   D++
Sbjct: 62  KVDVDEAEDLCSKYDVKMMPTFIFTKNGDAIEALEGCVEDEL 103


>DQ241300-1|ABB45864.1|  114|Caenorhabditis elegans TRX-1b protein.
          Length = 114

 Score = 43.2 bits (97), Expect = 2e-04
 Identities = 21/50 (42%), Positives = 34/50 (68%), Gaps = 3/50 (6%)
 Frame = +2

Query: 86  TEENVLVLSK-ANFETVITT--TEYILVEFYAPWCGHCKSLAPEYAKAAT 226
           T+E +L L+  ++FE +I     + I+++FYA WCG CK++AP Y + AT
Sbjct: 4   TKEPILELADMSDFEQLIRQHPEKIIILDFYATWCGPCKAIAPLYKELAT 53



 Score = 32.7 bits (71), Expect = 0.24
 Identities = 15/42 (35%), Positives = 22/42 (52%)
 Frame = +1

Query: 262 KVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDI 387
           KVD  + +DL   Y V+  PT  F +NG  I+   G   D++
Sbjct: 62  KVDVDEAEDLCSKYDVKMMPTFIFTKNGDAIEALEGCVEDEL 103


>U23168-7|AAC38808.1|  115|Caenorhabditis elegans Hypothetical
           protein B0228.5a protein.
          Length = 115

 Score = 41.1 bits (92), Expect = 7e-04
 Identities = 18/47 (38%), Positives = 31/47 (65%), Gaps = 2/47 (4%)
 Frame = +2

Query: 92  ENVLVLSKANFETVITT--TEYILVEFYAPWCGHCKSLAPEYAKAAT 226
           +N +   +++FE +I     + I+++FYA WCG CK++AP Y + AT
Sbjct: 8   KNQVKYFQSDFEQLIRQHPEKIIILDFYATWCGPCKAIAPLYKELAT 54



 Score = 32.7 bits (71), Expect = 0.24
 Identities = 15/42 (35%), Positives = 22/42 (52%)
 Frame = +1

Query: 262 KVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDI 387
           KVD  + +DL   Y V+  PT  F +NG  I+   G   D++
Sbjct: 63  KVDVDEAEDLCSKYDVKMMPTFIFTKNGDAIEALEGCVEDEL 104


>DQ241299-1|ABB45863.1|  115|Caenorhabditis elegans TRX-1a protein.
          Length = 115

 Score = 41.1 bits (92), Expect = 7e-04
 Identities = 18/47 (38%), Positives = 31/47 (65%), Gaps = 2/47 (4%)
 Frame = +2

Query: 92  ENVLVLSKANFETVITT--TEYILVEFYAPWCGHCKSLAPEYAKAAT 226
           +N +   +++FE +I     + I+++FYA WCG CK++AP Y + AT
Sbjct: 8   KNQVKYFQSDFEQLIRQHPEKIIILDFYATWCGPCKAIAPLYKELAT 54



 Score = 32.7 bits (71), Expect = 0.24
 Identities = 15/42 (35%), Positives = 22/42 (52%)
 Frame = +1

Query: 262 KVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDI 387
           KVD  + +DL   Y V+  PT  F +NG  I+   G   D++
Sbjct: 63  KVDVDEAEDLCSKYDVKMMPTFIFTKNGDAIEALEGCVEDEL 104


>Z69792-2|CAA93667.1|  417|Caenorhabditis elegans Hypothetical
           protein F40E10.3 protein.
          Length = 417

 Score = 39.5 bits (88), Expect = 0.002
 Identities = 23/89 (25%), Positives = 40/89 (44%), Gaps = 3/89 (3%)
 Frame = +1

Query: 250 YQLAKVDATQEQDLAESYGV-RGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAV 426
           Y    V+ T+E  L +   V +G  T+  +++G  I+Y+G R  +  +SWL      P  
Sbjct: 96  YNFYTVNTTKEHRLRKQEEVEKGEDTIHVYKDGYKIEYNGVRDPETFVSWLMDIPDDPVT 155

Query: 427 EVTSAEQAKEL--IDANTVIVFGFFSDQS 507
            +      +E   +D   V + G+F   S
Sbjct: 156 IINDEHDLEEFENMDDECVRIIGYFEPGS 184


>U41012-4|AAA82296.2|  413|Caenorhabditis elegans Hypothetical
           protein C06A6.5 protein.
          Length = 413

 Score = 39.5 bits (88), Expect = 0.002
 Identities = 21/71 (29%), Positives = 38/71 (53%), Gaps = 2/71 (2%)
 Frame = +1

Query: 259 AKVDATQEQDLAESYGVRGYPTLKFFRNGSPI--DYSGGRQADDIISWLKKKTGPPAVEV 432
           A VD+ ++ D+ + Y V  YPT+K F NG  I  +Y   R  + + +++K +      E 
Sbjct: 83  AIVDSQRQADIGDKYFVNKYPTMKVFVNGELITKEYRSTRSVEALTNFVKFQLSTAINEF 142

Query: 433 TSAEQAKELID 465
           +S +Q  + +D
Sbjct: 143 SSQDQLNQEMD 153


>U39646-7|AAA80371.1|  623|Caenorhabditis elegans Hypothetical
           protein F47B7.2a protein.
          Length = 623

 Score = 37.1 bits (82), Expect = 0.011
 Identities = 24/76 (31%), Positives = 40/76 (52%), Gaps = 1/76 (1%)
 Frame = +2

Query: 29  VLIFTAIALLGLALGDEVPTEENVLVLSKANFETVITTTEYI-LVEFYAPWCGHCKSLAP 205
           +L F+A    G +L D+   ++ +L L    F   I  ++    +EFY+ WCG C   AP
Sbjct: 30  ILAFSAGGSSGESLYDK---DDPILELDVDTFSAAIYGSKKAHFIEFYSSWCGACIGYAP 86

Query: 206 EYAKAATKLAEEESPI 253
            + K A +L E+ +P+
Sbjct: 87  TFKKFAKQL-EKWAPL 101


>U39646-6|AAK72058.1|  624|Caenorhabditis elegans Hypothetical
           protein F47B7.2c protein.
          Length = 624

 Score = 37.1 bits (82), Expect = 0.011
 Identities = 24/76 (31%), Positives = 40/76 (52%), Gaps = 1/76 (1%)
 Frame = +2

Query: 29  VLIFTAIALLGLALGDEVPTEENVLVLSKANFETVITTTEYI-LVEFYAPWCGHCKSLAP 205
           +L F+A    G +L D+   ++ +L L    F   I  ++    +EFY+ WCG C   AP
Sbjct: 30  ILAFSAGGSSGESLYDK---DDPILELDVDTFSAAIYGSKKAHFIEFYSSWCGACIGYAP 86

Query: 206 EYAKAATKLAEEESPI 253
            + K A +L E+ +P+
Sbjct: 87  TFKKFAKQL-EKWAPL 101


>U39646-5|AAK72057.1|  678|Caenorhabditis elegans Hypothetical
           protein F47B7.2b protein.
          Length = 678

 Score = 37.1 bits (82), Expect = 0.011
 Identities = 24/76 (31%), Positives = 40/76 (52%), Gaps = 1/76 (1%)
 Frame = +2

Query: 29  VLIFTAIALLGLALGDEVPTEENVLVLSKANFETVITTTEYI-LVEFYAPWCGHCKSLAP 205
           +L F+A    G +L D+   ++ +L L    F   I  ++    +EFY+ WCG C   AP
Sbjct: 30  ILAFSAGGSSGESLYDK---DDPILELDVDTFSAAIYGSKKAHFIEFYSSWCGACIGYAP 86

Query: 206 EYAKAATKLAEEESPI 253
            + K A +L E+ +P+
Sbjct: 87  TFKKFAKQL-EKWAPL 101


>Z71178-7|CAA94881.1|  119|Caenorhabditis elegans Hypothetical
           protein B0024.9 protein.
          Length = 119

 Score = 34.7 bits (76), Expect = 0.061
 Identities = 12/27 (44%), Positives = 20/27 (74%)
 Frame = +2

Query: 125 ETVITTTEYILVEFYAPWCGHCKSLAP 205
           E VI ++  ++V+F+A WCG C++L P
Sbjct: 24  EKVIQSSVPVIVDFHAEWCGPCQALGP 50



 Score = 34.7 bits (76), Expect = 0.061
 Identities = 22/59 (37%), Positives = 30/59 (50%), Gaps = 4/59 (6%)
 Frame = +1

Query: 226 KAG*RRISYQLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPID-YSG---GRQADDII 390
           K   R+ S  LAK++     +LA  YG+   PT+  F+NG  I  +SG     Q DD I
Sbjct: 55  KVNGRQGSVLLAKINVDHAGELAMDYGISAVPTVFAFKNGEKISGFSGVLDDEQLDDFI 113


>AF250045-1|AAG17620.1|  246|Caenorhabditis elegans thioredoxin-like
           protein DPY-11 protein.
          Length = 246

 Score = 34.7 bits (76), Expect = 0.061
 Identities = 21/58 (36%), Positives = 32/58 (55%), Gaps = 2/58 (3%)
 Frame = +2

Query: 32  LIFTAIALLGL-ALG-DEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSL 199
           ++   +A+LGL A+G    PT  + LV       T +   E+ ++EF+APWC  CK L
Sbjct: 1   MLLRLLAVLGLFAVGVSGGPTRSSKLVFLNEENWTDLMKGEW-MIEFHAPWCPACKDL 57



 Score = 32.7 bits (71), Expect = 0.24
 Identities = 16/55 (29%), Positives = 29/55 (52%)
 Frame = +1

Query: 244 ISYQLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKK 408
           +  ++ +VD T    L+  + V   PT+   ++G    YSG R  +D IS+++ K
Sbjct: 71  LGIKVGEVDVTVNPGLSGRFLVTALPTIYHVKDGVFRQYSGARDKNDFISFVEDK 125


>AF125955-2|AAD14719.1|  246|Caenorhabditis elegans Dumpy : shorter
           than wild-typeprotein 11 protein.
          Length = 246

 Score = 34.7 bits (76), Expect = 0.061
 Identities = 21/58 (36%), Positives = 32/58 (55%), Gaps = 2/58 (3%)
 Frame = +2

Query: 32  LIFTAIALLGL-ALG-DEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSL 199
           ++   +A+LGL A+G    PT  + LV       T +   E+ ++EF+APWC  CK L
Sbjct: 1   MLLRLLAVLGLFAVGVSGGPTRSSKLVFLNEENWTDLMKGEW-MIEFHAPWCPACKDL 57



 Score = 32.7 bits (71), Expect = 0.24
 Identities = 16/55 (29%), Positives = 29/55 (52%)
 Frame = +1

Query: 244 ISYQLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKK 408
           +  ++ +VD T    L+  + V   PT+   ++G    YSG R  +D IS+++ K
Sbjct: 71  LGIKVGEVDVTVNPGLSGRFLVTALPTIYHVKDGVFRQYSGARDKNDFISFVEDK 125


>U88167-3|AAB42224.2|  363|Caenorhabditis elegans Hypothetical
           protein D2092.4 protein.
          Length = 363

 Score = 33.9 bits (74), Expect = 0.11
 Identities = 13/48 (27%), Positives = 29/48 (60%), Gaps = 1/48 (2%)
 Frame = +1

Query: 262 KVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGG-RQADDIISWLK 402
           +V  T ++ +A   G+  +P+L ++R  +PI Y G  + ++ ++ WL+
Sbjct: 131 QVVKTNDRSVARELGINVFPSLVYYRRKNPILYDGDFKDSETLLRWLR 178


>AL110477-15|CAB54331.2|  295|Caenorhabditis elegans Hypothetical
           protein Y113G7B.9 protein.
          Length = 295

 Score = 33.9 bits (74), Expect = 0.11
 Identities = 16/62 (25%), Positives = 34/62 (54%)
 Frame = +2

Query: 29  VLIFTAIALLGLALGDEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPE 208
           +++F+ I  + L + + V  +++   +SKAN   ++ T   +L +F   +CGH    AP 
Sbjct: 184 IVLFSLILSIKLLMMNSVKHQQSNNQISKANRLALLDTCTVLLFDFLPAFCGHMWPTAPM 243

Query: 209 YA 214
           ++
Sbjct: 244 FS 245


>AF143900-1|AAF66677.1|  284|Caenorhabditis elegans thioredoxin-like
           protein protein.
          Length = 284

 Score = 31.9 bits (69), Expect = 0.43
 Identities = 10/20 (50%), Positives = 15/20 (75%)
 Frame = +2

Query: 152 ILVEFYAPWCGHCKSLAPEY 211
           ++V+F A WCG CK +AP +
Sbjct: 24  VIVDFTAVWCGPCKMIAPTF 43


>AF143405-1|AAF66636.1|  284|Caenorhabditis elegans thioredoxin-like
           protein TXL protein.
          Length = 284

 Score = 31.9 bits (69), Expect = 0.43
 Identities = 10/20 (50%), Positives = 15/20 (75%)
 Frame = +2

Query: 152 ILVEFYAPWCGHCKSLAPEY 211
           ++V+F A WCG CK +AP +
Sbjct: 24  VIVDFTAVWCGPCKMIAPTF 43


>AC024810-17|AAF60759.1|  284|Caenorhabditis elegans Hypothetical
           protein Y54E10A.3 protein.
          Length = 284

 Score = 31.9 bits (69), Expect = 0.43
 Identities = 10/20 (50%), Positives = 15/20 (75%)
 Frame = +2

Query: 152 ILVEFYAPWCGHCKSLAPEY 211
           ++V+F A WCG CK +AP +
Sbjct: 24  VIVDFTAVWCGPCKMIAPTF 43


>Z81044-3|CAB02808.1|  178|Caenorhabditis elegans Hypothetical
           protein C30H6.8 protein.
          Length = 178

 Score = 31.5 bits (68), Expect = 0.56
 Identities = 13/35 (37%), Positives = 19/35 (54%)
 Frame = +2

Query: 152 ILVEFYAPWCGHCKSLAPEYAKAATKLAEEESPIN 256
           ++V F A WCG CK L P+  K    + E ++  N
Sbjct: 54  VVVYFSAGWCGSCKFLTPKIKKFYNAVKESDAGKN 88


>Z81552-7|CAB04487.2|  606|Caenorhabditis elegans Hypothetical
           protein F56G4.5 protein.
          Length = 606

 Score = 30.7 bits (66), Expect = 0.99
 Identities = 8/18 (44%), Positives = 15/18 (83%)
 Frame = +2

Query: 152 ILVEFYAPWCGHCKSLAP 205
           I+++F+A WCG C+ ++P
Sbjct: 25  IIIDFFANWCGPCRMISP 42


>AL117201-5|CAB57916.1|  606|Caenorhabditis elegans Hypothetical
           protein F56G4.5 protein.
          Length = 606

 Score = 30.7 bits (66), Expect = 0.99
 Identities = 8/18 (44%), Positives = 15/18 (83%)
 Frame = +2

Query: 152 ILVEFYAPWCGHCKSLAP 205
           I+++F+A WCG C+ ++P
Sbjct: 25  IIIDFFANWCGPCRMISP 42


>AC024827-2|AAF60805.2|  254|Caenorhabditis elegans Hypothetical
           protein Y55F3AR.2 protein.
          Length = 254

 Score = 30.3 bits (65), Expect = 1.3
 Identities = 10/26 (38%), Positives = 17/26 (65%)
 Frame = +2

Query: 152 ILVEFYAPWCGHCKSLAPEYAKAATK 229
           + V+F A WCG C+ +AP ++  A +
Sbjct: 24  VFVDFTASWCGPCQYIAPIFSDLANQ 49


>AF016415-9|AAW88416.1|  297|Caenorhabditis elegans Serpentine
           receptor, class bc (class b-like) protein 36 protein.
          Length = 297

 Score = 29.9 bits (64), Expect = 1.7
 Identities = 16/62 (25%), Positives = 33/62 (53%)
 Frame = +2

Query: 29  VLIFTAIALLGLALGDEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPE 208
           ++IF+ +  + L + + V  ++N   LSKAN   ++     +L +F   +CG+    AP 
Sbjct: 184 IVIFSIMLSIRLFIWNMVKNKKNKNNLSKANRLALLDMCTVLLFDFLPSFCGNMWPTAPI 243

Query: 209 YA 214
           ++
Sbjct: 244 FS 245


>Z70780-8|CAA94825.2|  266|Caenorhabditis elegans Hypothetical
           protein F46B6.9 protein.
          Length = 266

 Score = 28.3 bits (60), Expect = 5.3
 Identities = 14/67 (20%), Positives = 27/67 (40%)
 Frame = -1

Query: 564 QILGHQQLEQLKGKFWLWLALVRKETKYNNSIGIDKFFSLFSRGDLNSRGASLLLQPTDD 385
           Q L H   ++L+  F  W+   R   +  +++ +D      S+G   SR +    +    
Sbjct: 158 QCLAHSDTKKLRADFMYWIEEERMSMRSRHNVSVDNRSDRSSKGSKASRASKSSARSAKS 217

Query: 384 VISLTTT 364
            I  T +
Sbjct: 218 EIGTTAS 224


>U70853-9|AAB09142.2|  158|Caenorhabditis elegans Hypothetical
           protein M01H9.1 protein.
          Length = 158

 Score = 28.3 bits (60), Expect = 5.3
 Identities = 10/34 (29%), Positives = 17/34 (50%)
 Frame = +2

Query: 152 ILVEFYAPWCGHCKSLAPEYAKAATKLAEEESPI 253
           +++ F A WCG C+   P   +   ++A    PI
Sbjct: 30  VVLYFSASWCGPCRQFTPIMKELYQQIAATNQPI 63


>AF106589-2|AAC78230.1|  107|Caenorhabditis elegans Hypothetical
           protein Y44E3A.3 protein.
          Length = 107

 Score = 28.3 bits (60), Expect = 5.3
 Identities = 11/47 (23%), Positives = 24/47 (51%), Gaps = 2/47 (4%)
 Frame = +2

Query: 95  NVLVLSKANFETVITT--TEYILVEFYAPWCGHCKSLAPEYAKAATK 229
           ++ +     F+T+     T+ +++ F A WCG C+ + P   + A +
Sbjct: 2   SIAIKDDDEFKTIFAEKKTQPVILFFTASWCGPCQMIKPRVEELAAE 48


>U39666-1|AAA80412.2|  644|Caenorhabditis elegans Nematode astacin
           protease protein33 protein.
          Length = 644

 Score = 27.9 bits (59), Expect = 6.9
 Identities = 21/96 (21%), Positives = 38/96 (39%), Gaps = 3/96 (3%)
 Frame = +1

Query: 238 RRISYQLAKVDATQEQDLAESYGVRGYPT---LKFFRNGSPIDYSGGRQADDIISWLKKK 408
           R I Y+    D   +  +    G+R Y     ++F  NG   DY    + +   S + + 
Sbjct: 204 RNIPYRFLDTDGNWQSQITN--GLRHYERNTCIRFSLNGGGSDYLVFSKGEGCYSSVGRL 261

Query: 409 TGPPAVEVTSAEQAKELIDANTVIVFGFFSDQS*PE 516
            GP  + +    +   +I        GF+ +Q+ PE
Sbjct: 262 GGPQEISIGDGCETLGIITHEVGHALGFWHEQARPE 297


>AJ561221-1|CAD99221.1|  302|Caenorhabditis elegans NAS-33 protein
           protein.
          Length = 302

 Score = 27.9 bits (59), Expect = 6.9
 Identities = 21/96 (21%), Positives = 38/96 (39%), Gaps = 3/96 (3%)
 Frame = +1

Query: 238 RRISYQLAKVDATQEQDLAESYGVRGYPT---LKFFRNGSPIDYSGGRQADDIISWLKKK 408
           R I Y+    D   +  +    G+R Y     ++F  NG   DY    + +   S + + 
Sbjct: 58  RNIPYRFLDTDGNWQSQITN--GLRHYERNTCIRFSLNGGGSDYLVFSKGEGCYSSVGRL 115

Query: 409 TGPPAVEVTSAEQAKELIDANTVIVFGFFSDQS*PE 516
            GP  + +    +   +I        GF+ +Q+ PE
Sbjct: 116 GGPQEISIGDGCETLGIITHEVGHALGFWHEQARPE 151


>U80443-6|AAK68201.1|  643|Caenorhabditis elegans Ferm domain
           (protein4.1-ezrin-radixin-moesin) family protein 4,
           isoform b protein.
          Length = 643

 Score = 27.5 bits (58), Expect = 9.2
 Identities = 12/29 (41%), Positives = 17/29 (58%)
 Frame = +3

Query: 204 RNTPRQQQSWLKKNLLSTSES*RNSRTGS 290
           R TPR +Q WLK+N L  +    N+ + S
Sbjct: 440 RQTPRVEQPWLKQNSLKVTTVHDNTASSS 468


>U80443-5|AAD32269.1|  635|Caenorhabditis elegans Ferm domain
           (protein4.1-ezrin-radixin-moesin) family protein 4,
           isoform a protein.
          Length = 635

 Score = 27.5 bits (58), Expect = 9.2
 Identities = 12/29 (41%), Positives = 17/29 (58%)
 Frame = +3

Query: 204 RNTPRQQQSWLKKNLLSTSES*RNSRTGS 290
           R TPR +Q WLK+N L  +    N+ + S
Sbjct: 432 RQTPRVEQPWLKQNSLKVTTVHDNTASSS 460


>U66261-1|AAB07022.1| 1525|Caenorhabditis elegans multidrug resistance
            related protein2 protein.
          Length = 1525

 Score = 27.5 bits (58), Expect = 9.2
 Identities = 15/41 (36%), Positives = 22/41 (53%)
 Frame = +2

Query: 50   ALLGLALGDEVPTEENVLVLSKANFETVITTTEYILVEFYA 172
            ALLG A+ ++VP +EN  ++ K   ET     E  +  F A
Sbjct: 922  ALLG-AISEDVPAQENTQLIEKETVETGKVKFEVYIAYFQA 961


>U41554-4|AAA83299.2| 1525|Caenorhabditis elegans Multidrug resistance
            protein familyprotein 2 protein.
          Length = 1525

 Score = 27.5 bits (58), Expect = 9.2
 Identities = 15/41 (36%), Positives = 22/41 (53%)
 Frame = +2

Query: 50   ALLGLALGDEVPTEENVLVLSKANFETVITTTEYILVEFYA 172
            ALLG A+ ++VP +EN  ++ K   ET     E  +  F A
Sbjct: 922  ALLG-AISEDVPAQENTQLIEKETVETGKVKFEVYIAYFQA 961


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 14,286,338
Number of Sequences: 27780
Number of extensions: 279812
Number of successful extensions: 852
Number of sequences better than 10.0: 49
Number of HSP's better than 10.0 without gapping: 746
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 844
length of database: 12,740,198
effective HSP length: 79
effective length of database: 10,545,578
effective search space used: 1518563232
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -