SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30112.Seq
         (446 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U00054-2|AAA50715.2| 13100|Caenorhabditis elegans Hypothetical p...    31   0.29 
AY117398-1|AAM78593.1| 13100|Caenorhabditis elegans mesocentin p...    31   0.29 
AL021471-1|CAA16295.1|  241|Caenorhabditis elegans Hypothetical ...    31   0.38 
Z19157-6|CAA79569.2| 1556|Caenorhabditis elegans Hypothetical pr...    29   1.2  
AC006633-3|AAK68375.1|  227|Caenorhabditis elegans Hypothetical ...    29   1.2  
Z68159-3|CAD89733.1|  351|Caenorhabditis elegans Hypothetical pr...    29   1.5  
Z68159-2|CAD89732.1|  354|Caenorhabditis elegans Hypothetical pr...    29   1.5  
Z30423-10|CAA83014.1|  216|Caenorhabditis elegans Hypothetical p...    28   2.7  
Z82278-10|CAC15860.2|  390|Caenorhabditis elegans Hypothetical p...    27   6.2  
U64857-3|AAM29666.1| 1487|Caenorhabditis elegans Hypothetical pr...    27   6.2  
U64857-2|AAC25867.1| 1558|Caenorhabditis elegans Hypothetical pr...    27   6.2  
U64857-1|AAC25868.1| 2167|Caenorhabditis elegans Hypothetical pr...    27   6.2  
AL132943-14|CAC14395.2|  390|Caenorhabditis elegans Hypothetical...    27   6.2  
Z82083-2|CAB04970.1|  263|Caenorhabditis elegans Hypothetical pr...    27   8.2  
U58751-9|AAB00660.1|  133|Caenorhabditis elegans Hypothetical pr...    27   8.2  

>U00054-2|AAA50715.2| 13100|Caenorhabditis elegans Hypothetical protein
             K07E12.1a protein.
          Length = 13100

 Score = 31.5 bits (68), Expect = 0.29
 Identities = 16/42 (38%), Positives = 22/42 (52%), Gaps = 2/42 (4%)
 Frame = +3

Query: 153   EDCPSDIRARTGLCPKQ--QKDGIECCYGVSVXETRVGSTAE 272
             ++CP  ++A  G CPK    KDG   CY +   ET  G  +E
Sbjct: 12962 DECPCKVKAHGGRCPKGYIAKDG--QCYDIDECETNNGQCSE 13001


>AY117398-1|AAM78593.1| 13100|Caenorhabditis elegans mesocentin protein.
          Length = 13100

 Score = 31.5 bits (68), Expect = 0.29
 Identities = 16/42 (38%), Positives = 22/42 (52%), Gaps = 2/42 (4%)
 Frame = +3

Query: 153   EDCPSDIRARTGLCPKQ--QKDGIECCYGVSVXETRVGSTAE 272
             ++CP  ++A  G CPK    KDG   CY +   ET  G  +E
Sbjct: 12962 DECPCKVKAHGGRCPKGYIAKDG--QCYDIDECETNNGQCSE 13001


>AL021471-1|CAA16295.1|  241|Caenorhabditis elegans Hypothetical
           protein Y17D7C.1 protein.
          Length = 241

 Score = 31.1 bits (67), Expect = 0.38
 Identities = 11/21 (52%), Positives = 15/21 (71%)
 Frame = +3

Query: 9   SEHVIMKFLLFCAMCILVYGN 71
           S+H+   FLLFC  C +VYG+
Sbjct: 88  SQHICRHFLLFCLQCRVVYGD 108


>Z19157-6|CAA79569.2| 1556|Caenorhabditis elegans Hypothetical protein
            ZC84.1 protein.
          Length = 1556

 Score = 29.5 bits (63), Expect = 1.2
 Identities = 15/46 (32%), Positives = 18/46 (39%)
 Frame = +3

Query: 87   CEIDSIEQEDPCRREGGLCTVAEDCPSDIRARTGLCPKQQKDGIEC 224
            CE    E   P +  GG C     C S+     GLC  + K G  C
Sbjct: 1196 CEDAKCECRPPLKAVGGFCQEEIQCSSNQVLHNGLCHNKAKLGEAC 1241


>AC006633-3|AAK68375.1|  227|Caenorhabditis elegans Hypothetical
           protein F35B3.4 protein.
          Length = 227

 Score = 29.5 bits (63), Expect = 1.2
 Identities = 13/35 (37%), Positives = 16/35 (45%)
 Frame = +3

Query: 159 CPSDIRARTGLCPKQQKDGIECCYGVSVXETRVGS 263
           CP    A    C  Q +D  +CCY  SV  T  G+
Sbjct: 113 CPMQAAADIQYCAAQGQDHTDCCYRNSVGTTLAGN 147


>Z68159-3|CAD89733.1|  351|Caenorhabditis elegans Hypothetical
           protein C33D9.3b protein.
          Length = 351

 Score = 29.1 bits (62), Expect = 1.5
 Identities = 20/59 (33%), Positives = 28/59 (47%)
 Frame = -2

Query: 190 SPVLALISDGQSSATVHKPPSLRHGSSCSMESISQKSSSLFP*TKMHIAQNNKNFMMTC 14
           SP ++  SD  S   V   P     SS S +S S KSS L   T++  ++ N+N    C
Sbjct: 55  SPTVSPPSDTSSPPNVIGCPETTSFSSTSRKSKSSKSSPLASPTRLVASELNRNTYSDC 113


>Z68159-2|CAD89732.1|  354|Caenorhabditis elegans Hypothetical
           protein C33D9.3a protein.
          Length = 354

 Score = 29.1 bits (62), Expect = 1.5
 Identities = 21/60 (35%), Positives = 29/60 (48%)
 Frame = -2

Query: 190 SPVLALISDGQSSATVHKPPSLRHGSSCSMESISQKSSSLFP*TKMHIAQNNKNFMMTCS 11
           SP ++  SD  S   V   P     SS S +S S KSS L   T++  ++ N+N   T S
Sbjct: 55  SPTVSPPSDTSSPPNVIGCPETTSFSSTSRKSKSSKSSPLASPTRLVASELNRNVSKTYS 114


>Z30423-10|CAA83014.1|  216|Caenorhabditis elegans Hypothetical
           protein T20G5.12 protein.
          Length = 216

 Score = 28.3 bits (60), Expect = 2.7
 Identities = 12/38 (31%), Positives = 16/38 (42%)
 Frame = +3

Query: 150 AEDCPSDIRARTGLCPKQQKDGIECCYGVSVXETRVGS 263
           + +CP +       C  Q KD  +CC    V  T  GS
Sbjct: 120 SSECPIEFLPEMQFCAAQGKDHSQCCSQSQVDATTAGS 157


>Z82278-10|CAC15860.2|  390|Caenorhabditis elegans Hypothetical
           protein Y116F11B.2 protein.
          Length = 390

 Score = 27.1 bits (57), Expect = 6.2
 Identities = 22/91 (24%), Positives = 32/91 (35%), Gaps = 9/91 (9%)
 Frame = +3

Query: 39  FCAMCILVYGN--------SEDDFC-EIDSIEQEDPCRREGGLCTVAEDCPSDIRARTGL 191
           FCA C+ VY N          D++C  +D +         G  C+    CPS   A    
Sbjct: 67  FCANCLQVYNNDCFGEGNPDADNWCVPVDEVPVTIDINAAGDQCSSTFQCPSGTFASFDY 126

Query: 192 CPKQQKDGIECCYGVSVXETRVGSTAENVSR 284
               ++ G+    G+         T  NV R
Sbjct: 127 GEPTEESGVNA--GMDPVTITCAETGANVGR 155


>U64857-3|AAM29666.1| 1487|Caenorhabditis elegans Hypothetical
           protein C37C3.6c protein.
          Length = 1487

 Score = 27.1 bits (57), Expect = 6.2
 Identities = 17/49 (34%), Positives = 24/49 (48%), Gaps = 2/49 (4%)
 Frame = +3

Query: 141 CTVAEDCPSDIRARTGLCPKQQKDGI-ECCYGVS-VXETRVGSTAENVS 281
           C V +DCP+ + +  G CP        E  +G S   ET  G  A+NV+
Sbjct: 696 CNV-DDCPTCVDSEFGCCPDNSTFATGEFNFGCSNCSETEFGCCADNVT 743


>U64857-2|AAC25867.1| 1558|Caenorhabditis elegans Hypothetical
           protein C37C3.6a protein.
          Length = 1558

 Score = 27.1 bits (57), Expect = 6.2
 Identities = 17/49 (34%), Positives = 24/49 (48%), Gaps = 2/49 (4%)
 Frame = +3

Query: 141 CTVAEDCPSDIRARTGLCPKQQKDGI-ECCYGVS-VXETRVGSTAENVS 281
           C V +DCP+ + +  G CP        E  +G S   ET  G  A+NV+
Sbjct: 696 CNV-DDCPTCVDSEFGCCPDNSTFATGEFNFGCSNCSETEFGCCADNVT 743


>U64857-1|AAC25868.1| 2167|Caenorhabditis elegans Hypothetical
           protein C37C3.6b protein.
          Length = 2167

 Score = 27.1 bits (57), Expect = 6.2
 Identities = 17/49 (34%), Positives = 24/49 (48%), Gaps = 2/49 (4%)
 Frame = +3

Query: 141 CTVAEDCPSDIRARTGLCPKQQKDGI-ECCYGVS-VXETRVGSTAENVS 281
           C V +DCP+ + +  G CP        E  +G S   ET  G  A+NV+
Sbjct: 696 CNV-DDCPTCVDSEFGCCPDNSTFATGEFNFGCSNCSETEFGCCADNVT 743


>AL132943-14|CAC14395.2|  390|Caenorhabditis elegans Hypothetical
           protein Y116F11B.2 protein.
          Length = 390

 Score = 27.1 bits (57), Expect = 6.2
 Identities = 22/91 (24%), Positives = 32/91 (35%), Gaps = 9/91 (9%)
 Frame = +3

Query: 39  FCAMCILVYGN--------SEDDFC-EIDSIEQEDPCRREGGLCTVAEDCPSDIRARTGL 191
           FCA C+ VY N          D++C  +D +         G  C+    CPS   A    
Sbjct: 67  FCANCLQVYNNDCFGEGNPDADNWCVPVDEVPVTIDINAAGDQCSSTFQCPSGTFASFDY 126

Query: 192 CPKQQKDGIECCYGVSVXETRVGSTAENVSR 284
               ++ G+    G+         T  NV R
Sbjct: 127 GEPTEESGVNA--GMDPVTITCAETGANVGR 155


>Z82083-2|CAB04970.1|  263|Caenorhabditis elegans Hypothetical
           protein ZK1010.4 protein.
          Length = 263

 Score = 26.6 bits (56), Expect = 8.2
 Identities = 12/42 (28%), Positives = 17/42 (40%)
 Frame = +3

Query: 135 GLCTVAEDCPSDIRARTGLCPKQQKDGIECCYGVSVXETRVG 260
           G+    + CP +  A    C  Q +D  +CC    V  T  G
Sbjct: 169 GMYFKTDGCPLEAAADMHFCAAQGRDHTQCCVRNGVTTTLAG 210


>U58751-9|AAB00660.1|  133|Caenorhabditis elegans Hypothetical
           protein C07G1.6 protein.
          Length = 133

 Score = 26.6 bits (56), Expect = 8.2
 Identities = 14/43 (32%), Positives = 21/43 (48%)
 Frame = -2

Query: 148 TVHKPPSLRHGSSCSMESISQKSSSLFP*TKMHIAQNNKNFMM 20
           T H PP +R  S+ +  S S  +SS  P  K H  + N   ++
Sbjct: 48  TAHTPPLIRASSTSASASASTSTSSSRP--KKHYLEKNMEHLL 88


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 9,310,757
Number of Sequences: 27780
Number of extensions: 192269
Number of successful extensions: 581
Number of sequences better than 10.0: 15
Number of HSP's better than 10.0 without gapping: 560
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 580
length of database: 12,740,198
effective HSP length: 75
effective length of database: 10,656,698
effective search space used: 777938954
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -