SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30111.Seq
         (593 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z66500-12|CAA91308.1|  549|Caenorhabditis elegans Hypothetical p...   146   1e-35
U07941-1|AAB05072.1|  549|Caenorhabditis elegans CCT-1 protein.       146   1e-35
Z68318-10|CAA92697.1|  529|Caenorhabditis elegans Hypothetical p...    87   9e-18
U25632-1|AAA93233.1|  529|Caenorhabditis elegans CCT-2 protein.        87   9e-18
AL031268-2|CAA20331.1|  529|Caenorhabditis elegans Hypothetical ...    87   9e-18
AC024136-4|AAF35963.3|  543|Caenorhabditis elegans Hypothetical ...    83   1e-16
Z35599-3|CAA84660.1|  542|Caenorhabditis elegans Hypothetical pr...    77   9e-15
Z32840-7|CAA83681.1|  542|Caenorhabditis elegans Hypothetical pr...    77   9e-15
U25698-1|AAA92843.1|  542|Caenorhabditis elegans CCT-5 protein.        77   9e-15
Z49068-8|CAA88861.1|  540|Caenorhabditis elegans Hypothetical pr...    69   2e-12
U25697-1|AAA92842.1|  540|Caenorhabditis elegans CCT-4 protein.        69   2e-12
AF067947-11|AAO25994.1|  455|Caenorhabditis elegans Hypothetical...    69   2e-12
AF067947-10|AAC19232.2|  535|Caenorhabditis elegans Hypothetical...    69   2e-12
AC024827-1|AAF60806.2|  581|Caenorhabditis elegans Hypothetical ...    65   4e-11
U13070-3|AAM22058.1|  429|Caenorhabditis elegans Chaperonin cont...    58   6e-09
U13070-2|AAC46642.1|  539|Caenorhabditis elegans Chaperonin cont...    58   6e-09
AC084153-6|AAK84594.1|  568|Caenorhabditis elegans Heat shock pr...    32   0.27 
Z81042-2|CAB02793.1|  458|Caenorhabditis elegans Hypothetical pr...    31   0.62 
L36035-1|AAA28077.1|  568|Caenorhabditis elegans HSP60 protein.        30   1.4  
Z96047-10|CAH04703.1|  195|Caenorhabditis elegans Hypothetical p...    28   5.8  
Z80215-19|CAH19104.1|  195|Caenorhabditis elegans Hypothetical p...    28   5.8  
AL021175-5|CAA15967.1|  357|Caenorhabditis elegans Hypothetical ...    27   7.6  

>Z66500-12|CAA91308.1|  549|Caenorhabditis elegans Hypothetical
           protein T05C12.7 protein.
          Length = 549

 Score =  146 bits (354), Expect = 1e-35
 Identities = 68/92 (73%), Positives = 81/92 (88%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           +K +EVEHPA KVLVELAQLQDEEVGDGTTSVVI+AAELLK ADELVK K+HPT+II+GY
Sbjct: 66  LKQLEVEHPAGKVLVELAQLQDEEVGDGTTSVVIVAAELLKRADELVKQKVHPTTIINGY 125

Query: 425 RLACKEAVKYIQDNLTVTVESLGRPSLITQPK 520
           RLACKEAVKYI +N++ T +S+GR S++   K
Sbjct: 126 RLACKEAVKYISENISFTSDSIGRQSVVNAAK 157



 Score = 82.2 bits (194), Expect = 3e-16
 Identities = 39/59 (66%), Positives = 46/59 (77%)
 Frame = +3

Query: 75  LSVAGTRSCGDPVRTQNVMXXXXXXNIVKSSLGPVGLDKMLVDDIGDVTVTNEGATILK 251
           L++ G R+ G  +R+QNV       NIVKSSLGPVGLDKMLVDD+GDV VTN+GATILK
Sbjct: 9   LALTGKRTTGQGIRSQNVTAAVAIANIVKSSLGPVGLDKMLVDDVGDVIVTNDGATILK 67



 Score = 46.0 bits (104), Expect = 2e-05
 Identities = 20/28 (71%), Positives = 25/28 (89%)
 Frame = +1

Query: 508 HTAKTTMSSKLIGADADFFSEMVVDAAQ 591
           + AKT+MSSK+IG DADFF E+VVDAA+
Sbjct: 154 NAAKTSMSSKIIGPDADFFGELVVDAAE 181


>U07941-1|AAB05072.1|  549|Caenorhabditis elegans CCT-1 protein.
          Length = 549

 Score =  146 bits (354), Expect = 1e-35
 Identities = 68/92 (73%), Positives = 81/92 (88%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           +K +EVEHPA KVLVELAQLQDEEVGDGTTSVVI+AAELLK ADELVK K+HPT+II+GY
Sbjct: 66  LKQLEVEHPAGKVLVELAQLQDEEVGDGTTSVVIVAAELLKRADELVKQKVHPTTIINGY 125

Query: 425 RLACKEAVKYIQDNLTVTVESLGRPSLITQPK 520
           RLACKEAVKYI +N++ T +S+GR S++   K
Sbjct: 126 RLACKEAVKYISENISFTSDSIGRQSVVNAAK 157



 Score = 82.2 bits (194), Expect = 3e-16
 Identities = 39/59 (66%), Positives = 46/59 (77%)
 Frame = +3

Query: 75  LSVAGTRSCGDPVRTQNVMXXXXXXNIVKSSLGPVGLDKMLVDDIGDVTVTNEGATILK 251
           L++ G R+ G  +R+QNV       NIVKSSLGPVGLDKMLVDD+GDV VTN+GATILK
Sbjct: 9   LALTGKRTTGQGIRSQNVTAAVAIANIVKSSLGPVGLDKMLVDDVGDVIVTNDGATILK 67



 Score = 46.0 bits (104), Expect = 2e-05
 Identities = 20/28 (71%), Positives = 25/28 (89%)
 Frame = +1

Query: 508 HTAKTTMSSKLIGADADFFSEMVVDAAQ 591
           + AKT+MSSK+IG DADFF E+VVDAA+
Sbjct: 154 NAAKTSMSSKIIGPDADFFGELVVDAAE 181


>Z68318-10|CAA92697.1|  529|Caenorhabditis elegans Hypothetical
           protein T21B10.7 protein.
          Length = 529

 Score = 87.0 bits (206), Expect = 9e-18
 Identities = 39/63 (61%), Positives = 53/63 (84%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           +K++ V++PAAKVLV+++  QD EVGDGTTSV ++AAELLK A++LV  +IHP +IISGY
Sbjct: 68  LKSIGVDNPAAKVLVDMSMTQDHEVGDGTTSVTVLAAELLKEAEKLVNQRIHPQTIISGY 127

Query: 425 RLA 433
           R A
Sbjct: 128 RRA 130



 Score = 44.8 bits (101), Expect = 5e-05
 Identities = 22/54 (40%), Positives = 34/54 (62%), Gaps = 4/54 (7%)
 Frame = +3

Query: 102 GDPVRTQNVMXXXXXXNIVKSSLGPVGLDKMLV----DDIGDVTVTNEGATILK 251
           G+  R  + +      ++VKS+LGP G+DK+L+    +  G + VTN+GATILK
Sbjct: 16  GESARLSSFVGAIAIGDLVKSTLGPKGMDKILISGNPESAGGIKVTNDGATILK 69


>U25632-1|AAA93233.1|  529|Caenorhabditis elegans CCT-2 protein.
          Length = 529

 Score = 87.0 bits (206), Expect = 9e-18
 Identities = 39/63 (61%), Positives = 53/63 (84%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           +K++ V++PAAKVLV+++  QD EVGDGTTSV ++AAELLK A++LV  +IHP +IISGY
Sbjct: 68  LKSIGVDNPAAKVLVDMSMTQDHEVGDGTTSVTVLAAELLKEAEKLVNQRIHPQTIISGY 127

Query: 425 RLA 433
           R A
Sbjct: 128 RRA 130



 Score = 44.8 bits (101), Expect = 5e-05
 Identities = 22/54 (40%), Positives = 34/54 (62%), Gaps = 4/54 (7%)
 Frame = +3

Query: 102 GDPVRTQNVMXXXXXXNIVKSSLGPVGLDKMLV----DDIGDVTVTNEGATILK 251
           G+  R  + +      ++VKS+LGP G+DK+L+    +  G + VTN+GATILK
Sbjct: 16  GESARLSSFVGAIAIGDLVKSTLGPKGMDKILISGNPESAGGIKVTNDGATILK 69


>AL031268-2|CAA20331.1|  529|Caenorhabditis elegans Hypothetical
           protein T21B10.7 protein.
          Length = 529

 Score = 87.0 bits (206), Expect = 9e-18
 Identities = 39/63 (61%), Positives = 53/63 (84%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           +K++ V++PAAKVLV+++  QD EVGDGTTSV ++AAELLK A++LV  +IHP +IISGY
Sbjct: 68  LKSIGVDNPAAKVLVDMSMTQDHEVGDGTTSVTVLAAELLKEAEKLVNQRIHPQTIISGY 127

Query: 425 RLA 433
           R A
Sbjct: 128 RRA 130



 Score = 44.8 bits (101), Expect = 5e-05
 Identities = 22/54 (40%), Positives = 34/54 (62%), Gaps = 4/54 (7%)
 Frame = +3

Query: 102 GDPVRTQNVMXXXXXXNIVKSSLGPVGLDKMLV----DDIGDVTVTNEGATILK 251
           G+  R  + +      ++VKS+LGP G+DK+L+    +  G + VTN+GATILK
Sbjct: 16  GESARLSSFVGAIAIGDLVKSTLGPKGMDKILISGNPESAGGIKVTNDGATILK 69


>AC024136-4|AAF35963.3|  543|Caenorhabditis elegans Hypothetical
           protein F54A3.3 protein.
          Length = 543

 Score = 83.0 bits (196), Expect = 1e-16
 Identities = 34/80 (42%), Positives = 58/80 (72%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           ++ + V+HPAAK ++E+A+ QDEE GDGTTSV+I+A E++ +A   ++ K HPT II  Y
Sbjct: 69  LREITVKHPAAKSMIEIARTQDEETGDGTTSVIILAGEVMAHAQTYLEQKTHPTLIIKAY 128

Query: 425 RLACKEAVKYIQDNLTVTVE 484
           R A ++ +++ ++  + TV+
Sbjct: 129 RQALEDMIQWSENKFSKTVD 148



 Score = 43.2 bits (97), Expect = 1e-04
 Identities = 20/59 (33%), Positives = 34/59 (57%)
 Frame = +3

Query: 75  LSVAGTRSCGDPVRTQNVMXXXXXXNIVKSSLGPVGLDKMLVDDIGDVTVTNEGATILK 251
           LS    R  G  V+  N+       +++++SLGP  + KML+D +G + +TN+G  IL+
Sbjct: 12  LSQGTKRESGHQVQIGNINACKTIADVIRTSLGPRAMLKMLMDPMGGIVMTNDGNAILR 70


>Z35599-3|CAA84660.1|  542|Caenorhabditis elegans Hypothetical
           protein C07G2.3a protein.
          Length = 542

 Score = 77.0 bits (181), Expect = 9e-15
 Identities = 32/69 (46%), Positives = 52/69 (75%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           ++ ++V+H  AK++VEL++ QD E+GDGTT VV++A  LL+ A++L+   IHP  I  G+
Sbjct: 79  MEKMDVQHHVAKLMVELSKSQDHEIGDGTTGVVVLAGALLEEAEKLIDRGIHPIKIADGF 138

Query: 425 RLACKEAVK 451
            LACK+A++
Sbjct: 139 DLACKKALE 147



 Score = 50.8 bits (116), Expect = 7e-07
 Identities = 22/34 (64%), Positives = 29/34 (85%)
 Frame = +3

Query: 150 NIVKSSLGPVGLDKMLVDDIGDVTVTNEGATILK 251
           N +++SLGP GLDKMLV   GDVT+TN+GATI++
Sbjct: 47  NTLRTSLGPRGLDKMLVSPDGDVTITNDGATIME 80


>Z32840-7|CAA83681.1|  542|Caenorhabditis elegans Hypothetical
           protein C07G2.3a protein.
          Length = 542

 Score = 77.0 bits (181), Expect = 9e-15
 Identities = 32/69 (46%), Positives = 52/69 (75%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           ++ ++V+H  AK++VEL++ QD E+GDGTT VV++A  LL+ A++L+   IHP  I  G+
Sbjct: 79  MEKMDVQHHVAKLMVELSKSQDHEIGDGTTGVVVLAGALLEEAEKLIDRGIHPIKIADGF 138

Query: 425 RLACKEAVK 451
            LACK+A++
Sbjct: 139 DLACKKALE 147



 Score = 50.8 bits (116), Expect = 7e-07
 Identities = 22/34 (64%), Positives = 29/34 (85%)
 Frame = +3

Query: 150 NIVKSSLGPVGLDKMLVDDIGDVTVTNEGATILK 251
           N +++SLGP GLDKMLV   GDVT+TN+GATI++
Sbjct: 47  NTLRTSLGPRGLDKMLVSPDGDVTITNDGATIME 80


>U25698-1|AAA92843.1|  542|Caenorhabditis elegans CCT-5 protein.
          Length = 542

 Score = 77.0 bits (181), Expect = 9e-15
 Identities = 32/69 (46%), Positives = 52/69 (75%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           ++ ++V+H  AK++VEL++ QD E+GDGTT VV++A  LL+ A++L+   IHP  I  G+
Sbjct: 79  MEKMDVQHHVAKLMVELSKSQDHEIGDGTTGVVVLAGALLEEAEKLIDRGIHPIKIADGF 138

Query: 425 RLACKEAVK 451
            LACK+A++
Sbjct: 139 DLACKKALE 147



 Score = 50.8 bits (116), Expect = 7e-07
 Identities = 22/34 (64%), Positives = 29/34 (85%)
 Frame = +3

Query: 150 NIVKSSLGPVGLDKMLVDDIGDVTVTNEGATILK 251
           N +++SLGP GLDKMLV   GDVT+TN+GATI++
Sbjct: 47  NTLRTSLGPRGLDKMLVSPDGDVTITNDGATIME 80


>Z49068-8|CAA88861.1|  540|Caenorhabditis elegans Hypothetical
           protein K01C8.10 protein.
          Length = 540

 Score = 69.3 bits (162), Expect = 2e-12
 Identities = 33/73 (45%), Positives = 47/73 (64%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           +  + V HP AK+LVEL++ QD E GDGTT+VV++A  LL  A  L+   IHPT+I   +
Sbjct: 77  LNQMSVIHPTAKMLVELSKAQDIEAGDGTTTVVVMAGALLDAAQNLLSKGIHPTTISESF 136

Query: 425 RLACKEAVKYIQD 463
           + A  EA K + +
Sbjct: 137 QSAAAEAEKILDE 149



 Score = 52.0 bits (119), Expect = 3e-07
 Identities = 23/48 (47%), Positives = 33/48 (68%)
 Frame = +3

Query: 105 DPVRTQNVMXXXXXXNIVKSSLGPVGLDKMLVDDIGDVTVTNEGATIL 248
           + VR  N++      + V++SLGP G+DKM+    GDVT+TN+GATIL
Sbjct: 30  ESVRNSNIVAAKAVADAVRTSLGPRGMDKMIQSGNGDVTITNDGATIL 77


>U25697-1|AAA92842.1|  540|Caenorhabditis elegans CCT-4 protein.
          Length = 540

 Score = 69.3 bits (162), Expect = 2e-12
 Identities = 33/73 (45%), Positives = 47/73 (64%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           +  + V HP AK+LVEL++ QD E GDGTT+VV++A  LL  A  L+   IHPT+I   +
Sbjct: 77  LNQMSVIHPTAKMLVELSKAQDIEAGDGTTTVVVMAGALLDAAQNLLSKGIHPTTISESF 136

Query: 425 RLACKEAVKYIQD 463
           + A  EA K + +
Sbjct: 137 QSAAAEAEKILDE 149



 Score = 52.0 bits (119), Expect = 3e-07
 Identities = 23/48 (47%), Positives = 33/48 (68%)
 Frame = +3

Query: 105 DPVRTQNVMXXXXXXNIVKSSLGPVGLDKMLVDDIGDVTVTNEGATIL 248
           + VR  N++      + V++SLGP G+DKM+    GDVT+TN+GATIL
Sbjct: 30  ESVRNSNIVAAKAVADAVRTSLGPRGMDKMIQSGNGDVTITNDGATIL 77


>AF067947-11|AAO25994.1|  455|Caenorhabditis elegans Hypothetical
           protein T10B5.5b protein.
          Length = 455

 Score = 69.3 bits (162), Expect = 2e-12
 Identities = 30/73 (41%), Positives = 49/73 (67%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           +K +++  PAA  +V++A+ QD EVGDGTTSVV++AAE+LK     ++  +HP  +I   
Sbjct: 66  LKLLDIVFPAASTMVDIARSQDAEVGDGTTSVVVLAAEILKQMKPFIEDGVHPQLLIRAI 125

Query: 425 RLACKEAVKYIQD 463
             AC++ +K + D
Sbjct: 126 GKACEKTLKNLAD 138



 Score = 46.0 bits (104), Expect = 2e-05
 Identities = 18/33 (54%), Positives = 28/33 (84%)
 Frame = +3

Query: 156 VKSSLGPVGLDKMLVDDIGDVTVTNEGATILKM 254
           ++++LGP GLDK++VD  G  T++N+GATILK+
Sbjct: 36  IRTTLGPRGLDKLIVDSKGATTISNDGATILKL 68



 Score = 30.7 bits (66), Expect = 0.82
 Identities = 13/24 (54%), Positives = 18/24 (75%)
 Frame = +1

Query: 514 AKTTMSSKLIGADADFFSEMVVDA 585
           A TT+SSKL+  +  FF+ M+VDA
Sbjct: 157 AATTLSSKLVSQERLFFANMIVDA 180


>AF067947-10|AAC19232.2|  535|Caenorhabditis elegans Hypothetical
           protein T10B5.5a protein.
          Length = 535

 Score = 69.3 bits (162), Expect = 2e-12
 Identities = 30/73 (41%), Positives = 49/73 (67%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           +K +++  PAA  +V++A+ QD EVGDGTTSVV++AAE+LK     ++  +HP  +I   
Sbjct: 66  LKLLDIVFPAASTMVDIARSQDAEVGDGTTSVVVLAAEILKQMKPFIEDGVHPQLLIRAI 125

Query: 425 RLACKEAVKYIQD 463
             AC++ +K + D
Sbjct: 126 GKACEKTLKNLAD 138



 Score = 46.0 bits (104), Expect = 2e-05
 Identities = 18/33 (54%), Positives = 28/33 (84%)
 Frame = +3

Query: 156 VKSSLGPVGLDKMLVDDIGDVTVTNEGATILKM 254
           ++++LGP GLDK++VD  G  T++N+GATILK+
Sbjct: 36  IRTTLGPRGLDKLIVDSKGATTISNDGATILKL 68



 Score = 30.7 bits (66), Expect = 0.82
 Identities = 13/24 (54%), Positives = 18/24 (75%)
 Frame = +1

Query: 514 AKTTMSSKLIGADADFFSEMVVDA 585
           A TT+SSKL+  +  FF+ M+VDA
Sbjct: 157 AATTLSSKLVSQERLFFANMIVDA 180


>AC024827-1|AAF60806.2|  581|Caenorhabditis elegans Hypothetical
           protein Y55F3AR.3 protein.
          Length = 581

 Score = 64.9 bits (151), Expect = 4e-11
 Identities = 24/71 (33%), Positives = 51/71 (71%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           +K +E++HPAA++++   ++Q++++GD T +VVI+AA LL++A  L+   + P  + +GY
Sbjct: 72  LKELEIQHPAARIIIMATEMQEKQIGDNTNTVVILAAALLEHAANLIHMGMTPQEVAAGY 131

Query: 425 RLACKEAVKYI 457
             A ++A++ +
Sbjct: 132 EQAAEKALEIL 142



 Score = 37.1 bits (82), Expect = 0.009
 Identities = 17/49 (34%), Positives = 30/49 (61%)
 Frame = +3

Query: 105 DPVRTQNVMXXXXXXNIVKSSLGPVGLDKMLVDDIGDVTVTNEGATILK 251
           D    +N+       + ++S+ GP G++KM+++ I  + VTN+ ATILK
Sbjct: 25  DEAVQRNIEACTELASQIRSAYGPNGMNKMVINHIEKLFVTNDAATILK 73


>U13070-3|AAM22058.1|  429|Caenorhabditis elegans Chaperonin
           containing tcp-1 protein6, isoform b protein.
          Length = 429

 Score = 57.6 bits (133), Expect = 6e-09
 Identities = 23/72 (31%), Positives = 43/72 (59%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           +  + ++HP A ++ + +  QD+  GDGTTS V++  ELLK A+ LV   +HP  +  G+
Sbjct: 64  LHEMAIQHPTASMIAKASTAQDDVTGDGTTSTVLLIGELLKQAESLVLEGLHPRIVTEGF 123

Query: 425 RLACKEAVKYIQ 460
             A  + ++ ++
Sbjct: 124 EWANTKTLELLE 135



 Score = 35.5 bits (78), Expect = 0.029
 Identities = 15/42 (35%), Positives = 25/42 (59%)
 Frame = +3

Query: 123 NVMXXXXXXNIVKSSLGPVGLDKMLVDDIGDVTVTNEGATIL 248
           N+       ++++S+LGP G  KMLV   GD+ +T +G  +L
Sbjct: 23  NISGARGLQDVMRSNLGPKGTLKMLVSGAGDIKLTKDGNVLL 64


>U13070-2|AAC46642.1|  539|Caenorhabditis elegans Chaperonin
           containing tcp-1 protein6, isoform a protein.
          Length = 539

 Score = 57.6 bits (133), Expect = 6e-09
 Identities = 23/72 (31%), Positives = 43/72 (59%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           +  + ++HP A ++ + +  QD+  GDGTTS V++  ELLK A+ LV   +HP  +  G+
Sbjct: 64  LHEMAIQHPTASMIAKASTAQDDVTGDGTTSTVLLIGELLKQAESLVLEGLHPRIVTEGF 123

Query: 425 RLACKEAVKYIQ 460
             A  + ++ ++
Sbjct: 124 EWANTKTLELLE 135



 Score = 35.5 bits (78), Expect = 0.029
 Identities = 15/42 (35%), Positives = 25/42 (59%)
 Frame = +3

Query: 123 NVMXXXXXXNIVKSSLGPVGLDKMLVDDIGDVTVTNEGATIL 248
           N+       ++++S+LGP G  KMLV   GD+ +T +G  +L
Sbjct: 23  NISGARGLQDVMRSNLGPKGTLKMLVSGAGDIKLTKDGNVLL 64


>AC084153-6|AAK84594.1|  568|Caenorhabditis elegans Heat shock
           protein protein 60 protein.
          Length = 568

 Score = 32.3 bits (70), Expect = 0.27
 Identities = 13/38 (34%), Positives = 23/38 (60%)
 Frame = +2

Query: 275 AKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVK 388
           AK++ ++A   +EE GDGTT   ++A  + K   E ++
Sbjct: 86  AKLIQDVANKANEEAGDGTTCATVLARAIAKEGFESIR 123


>Z81042-2|CAB02793.1|  458|Caenorhabditis elegans Hypothetical
           protein C27H6.2 protein.
          Length = 458

 Score = 31.1 bits (67), Expect = 0.62
 Identities = 21/80 (26%), Positives = 36/80 (45%)
 Frame = +2

Query: 233 RCHNIKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSI 412
           +C   + V +  P A     +A    +E+GDG   V ++A+E+  N  E+ KT++   S 
Sbjct: 78  KCMAGRAVLIAGPPATGKTAIALAMSQELGDGVPFVPLVASEVFSN--EVKKTEVLMRSF 135

Query: 413 ISGYRLACKEAVKYIQDNLT 472
                L  KE     +  +T
Sbjct: 136 RRAIGLRVKETKDVYEGEVT 155


>L36035-1|AAA28077.1|  568|Caenorhabditis elegans HSP60 protein.
          Length = 568

 Score = 29.9 bits (64), Expect = 1.4
 Identities = 16/58 (27%), Positives = 28/58 (48%)
 Frame = +2

Query: 275 AKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGYRLACKEAV 448
           AK++ ++A   +EE GDGTT   ++   + K   E   ++ +   I  G   A +  V
Sbjct: 86  AKLIQDVANKANEEAGDGTTCATVLTRAIAKEGFERHSSRGNAVEIRRGVMNAVEVVV 143


>Z96047-10|CAH04703.1|  195|Caenorhabditis elegans Hypothetical
           protein DY3.8 protein.
          Length = 195

 Score = 27.9 bits (59), Expect = 5.8
 Identities = 16/41 (39%), Positives = 22/41 (53%)
 Frame = -1

Query: 242 CGTFVSDCNIPNIVNQHLIQTNWPKGALYYVCYSRCCHYIL 120
           CG  V  C+I  IVN +L++  W  G L Y+  S    Y+L
Sbjct: 71  CGMAV--CSIIVIVNHYLLEKKWVWGGLLYL--SNIMFYVL 107


>Z80215-19|CAH19104.1|  195|Caenorhabditis elegans Hypothetical
           protein DY3.8 protein.
          Length = 195

 Score = 27.9 bits (59), Expect = 5.8
 Identities = 16/41 (39%), Positives = 22/41 (53%)
 Frame = -1

Query: 242 CGTFVSDCNIPNIVNQHLIQTNWPKGALYYVCYSRCCHYIL 120
           CG  V  C+I  IVN +L++  W  G L Y+  S    Y+L
Sbjct: 71  CGMAV--CSIIVIVNHYLLEKKWVWGGLLYL--SNIMFYVL 107


>AL021175-5|CAA15967.1|  357|Caenorhabditis elegans Hypothetical
           protein Y6E2A.6 protein.
          Length = 357

 Score = 27.5 bits (58), Expect = 7.6
 Identities = 14/32 (43%), Positives = 18/32 (56%)
 Frame = -3

Query: 117 FSLGLRRILSLLQTKVQL*STFFIVFLTQNSL 22
           F L    ILS +QT V +  TF IVF T  ++
Sbjct: 14  FYLRASHILSCIQTPVNIFGTFIIVFKTPKNM 45


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 13,185,961
Number of Sequences: 27780
Number of extensions: 258110
Number of successful extensions: 612
Number of sequences better than 10.0: 22
Number of HSP's better than 10.0 without gapping: 573
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 609
length of database: 12,740,198
effective HSP length: 78
effective length of database: 10,573,358
effective search space used: 1258229602
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -