SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30110.Seq
         (444 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z82077-3|CAB63331.1|  122|Caenorhabditis elegans Hypothetical pr...   109   1e-24
Z82077-4|CAB63332.1|   70|Caenorhabditis elegans Hypothetical pr...    53   8e-08
U61953-6|AAO91706.1|  341|Caenorhabditis elegans Hypothetical pr...    27   6.1  
U29380-18|ABB88224.1|  733|Caenorhabditis elegans Zygote defecti...    27   8.1  
U29380-17|AAA68733.3|  736|Caenorhabditis elegans Zygote defecti...    27   8.1  
U29380-16|AAS60254.1|  761|Caenorhabditis elegans Zygote defecti...    27   8.1  
U29380-15|AAS60253.1|  777|Caenorhabditis elegans Zygote defecti...    27   8.1  
AY487140-1|AAR32790.1|  733|Caenorhabditis elegans centrosome at...    27   8.1  

>Z82077-3|CAB63331.1|  122|Caenorhabditis elegans Hypothetical
           protein W09C5.6a protein.
          Length = 122

 Score =  109 bits (261), Expect = 1e-24
 Identities = 48/75 (64%), Positives = 61/75 (81%)
 Frame = +2

Query: 47  PKGERKGKSAINEVVTREYTVNLHKRLHGVGFKKRAPRAIKEIRKFAEKQMGTPDIRVDT 226
           PK E+K +S INEVVTREYT+++H R+ G+G KKRAPRAI EI+KFA+ QM T D+RVDT
Sbjct: 3   PKNEKKSRSTINEVVTREYTIHIHARIRGIGSKKRAPRAIDEIKKFAKIQMKTNDVRVDT 62

Query: 227 RLNKFLWSKESEMFP 271
           +LNKF+WSK  +  P
Sbjct: 63  KLNKFIWSKGIKNVP 77



 Score = 53.2 bits (122), Expect = 8e-08
 Identities = 23/51 (45%), Positives = 31/51 (60%)
 Frame = +1

Query: 253 GVRNVPFXXXXXXXXXXNDDEDSAHKLFTLVTYVPVASIKGLQTENVDASQ 405
           G++NVP+          N+DEDSA KL+TL TYVP  +  GL   NVD+ +
Sbjct: 72  GIKNVPYRVRVRLSRRRNEDEDSAQKLYTLCTYVPCTNFHGLTNVNVDSEE 122


>Z82077-4|CAB63332.1|   70|Caenorhabditis elegans Hypothetical
           protein W09C5.6b protein.
          Length = 70

 Score = 53.2 bits (122), Expect = 8e-08
 Identities = 23/51 (45%), Positives = 31/51 (60%)
 Frame = +1

Query: 253 GVRNVPFXXXXXXXXXXNDDEDSAHKLFTLVTYVPVASIKGLQTENVDASQ 405
           G++NVP+          N+DEDSA KL+TL TYVP  +  GL   NVD+ +
Sbjct: 20  GIKNVPYRVRVRLSRRRNEDEDSAQKLYTLCTYVPCTNFHGLTNVNVDSEE 70



 Score = 36.7 bits (81), Expect = 0.008
 Identities = 15/25 (60%), Positives = 19/25 (76%)
 Frame = +2

Query: 197 MGTPDIRVDTRLNKFLWSKESEMFP 271
           M T D+RVDT+LNKF+WSK  +  P
Sbjct: 1   MKTNDVRVDTKLNKFIWSKGIKNVP 25


>U61953-6|AAO91706.1|  341|Caenorhabditis elegans Hypothetical
           protein R08C7.9 protein.
          Length = 341

 Score = 27.1 bits (57), Expect = 6.1
 Identities = 14/50 (28%), Positives = 24/50 (48%)
 Frame = +2

Query: 134 VGFKKRAPRAIKEIRKFAEKQMGTPDIRVDTRLNKFLWSKESEMFPSVSV 283
           +GF   + R   +  +   K M + D+ +D  +  F+W+   E  PSV V
Sbjct: 51  IGFALISKRTKDQAERLNVK-MKSVDVWIDEAIKIFIWADSDERIPSVFV 99


>U29380-18|ABB88224.1|  733|Caenorhabditis elegans Zygote defective:
           embryonic lethalprotein 12, isoform d protein.
          Length = 733

 Score = 26.6 bits (56), Expect = 8.1
 Identities = 10/35 (28%), Positives = 22/35 (62%)
 Frame = -1

Query: 105 VYSRVTTSFMADLPFLSPLGLAIVILSFVYQKKKK 1
           ++ R+   + +DLP +  LG+A+V L+ + +  K+
Sbjct: 137 IHERIDGIYESDLPAMVNLGMAVVTLAHIGKNAKR 171


>U29380-17|AAA68733.3|  736|Caenorhabditis elegans Zygote defective:
           embryonic lethalprotein 12, isoform a protein.
          Length = 736

 Score = 26.6 bits (56), Expect = 8.1
 Identities = 10/35 (28%), Positives = 22/35 (62%)
 Frame = -1

Query: 105 VYSRVTTSFMADLPFLSPLGLAIVILSFVYQKKKK 1
           ++ R+   + +DLP +  LG+A+V L+ + +  K+
Sbjct: 137 IHERIDGIYESDLPAMVNLGMAVVTLAHIGKNAKR 171


>U29380-16|AAS60254.1|  761|Caenorhabditis elegans Zygote defective:
           embryonic lethalprotein 12, isoform c protein.
          Length = 761

 Score = 26.6 bits (56), Expect = 8.1
 Identities = 10/35 (28%), Positives = 22/35 (62%)
 Frame = -1

Query: 105 VYSRVTTSFMADLPFLSPLGLAIVILSFVYQKKKK 1
           ++ R+   + +DLP +  LG+A+V L+ + +  K+
Sbjct: 137 IHERIDGIYESDLPAMVNLGMAVVTLAHIGKNAKR 171


>U29380-15|AAS60253.1|  777|Caenorhabditis elegans Zygote defective:
           embryonic lethalprotein 12, isoform b protein.
          Length = 777

 Score = 26.6 bits (56), Expect = 8.1
 Identities = 10/35 (28%), Positives = 22/35 (62%)
 Frame = -1

Query: 105 VYSRVTTSFMADLPFLSPLGLAIVILSFVYQKKKK 1
           ++ R+   + +DLP +  LG+A+V L+ + +  K+
Sbjct: 137 IHERIDGIYESDLPAMVNLGMAVVTLAHIGKNAKR 171


>AY487140-1|AAR32790.1|  733|Caenorhabditis elegans centrosome
           attachment protein A protein.
          Length = 733

 Score = 26.6 bits (56), Expect = 8.1
 Identities = 10/35 (28%), Positives = 22/35 (62%)
 Frame = -1

Query: 105 VYSRVTTSFMADLPFLSPLGLAIVILSFVYQKKKK 1
           ++ R+   + +DLP +  LG+A+V L+ + +  K+
Sbjct: 137 IHERIDGIYESDLPAMVNLGMAVVTLAHIGKNAKR 171


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 9,579,534
Number of Sequences: 27780
Number of extensions: 181263
Number of successful extensions: 403
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 387
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 403
length of database: 12,740,198
effective HSP length: 75
effective length of database: 10,656,698
effective search space used: 767282256
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -