SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30108.Seq
         (591 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z68227-10|CAA92515.1|   95|Caenorhabditis elegans Hypothetical p...    64   9e-11
U97593-4|AAB52877.2|   93|Caenorhabditis elegans Hypothetical pr...    52   2e-07
AL110478-10|CAE17956.3|  758|Caenorhabditis elegans Hypothetical...    30   1.1  
Z83128-7|CAB05634.2|  243|Caenorhabditis elegans Hypothetical pr...    28   4.3  
U29157-1|AAA68423.4|  675|Caenorhabditis elegans Hypothetical pr...    28   4.3  
AF039717-4|AAO21385.1|  303|Caenorhabditis elegans Abnormal daue...    28   4.3  
AF039717-3|AAK82917.1|  530|Caenorhabditis elegans Abnormal daue...    28   4.3  
AF039717-2|AAK82918.1|  508|Caenorhabditis elegans Abnormal daue...    28   4.3  
AF039717-1|AAK82919.1|  510|Caenorhabditis elegans Abnormal daue...    28   4.3  
AF032112-1|AAC47803.1|  510|Caenorhabditis elegans DAF-16 protein.     28   4.3  
AF020344-1|AAB84392.1|  530|Caenorhabditis elegans fork head-rel...    28   4.3  
AF020343-1|AAB84391.1|  508|Caenorhabditis elegans fork head-rel...    28   4.3  
AF020342-1|AAB84390.1|  510|Caenorhabditis elegans fork head-rel...    28   4.3  
AC006618-3|AAK68251.3|  960|Caenorhabditis elegans Patched relat...    28   4.3  
U41995-2|AAA83460.1|  317|Caenorhabditis elegans Serpentine rece...    28   5.7  
U28738-3|AAA68310.2|  468|Caenorhabditis elegans Hypothetical pr...    27   10.0 
AC006795-1|AAF59492.2|  435|Caenorhabditis elegans Hypothetical ...    27   10.0 

>Z68227-10|CAA92515.1|   95|Caenorhabditis elegans Hypothetical
           protein F49C12.12 protein.
          Length = 95

 Score = 63.7 bits (148), Expect = 9e-11
 Identities = 34/76 (44%), Positives = 47/76 (61%)
 Frame = +1

Query: 1   KLSLCGLVLSVWGIIQLTLMGVFYYIRAVALLEDLPFDEKNPPHSIEDFVIEVEKGYTLN 180
           K+S   +V+SVWG+I L L+GVF+YI+AV L  DL F+       +   VI+ +  Y   
Sbjct: 11  KMSAFCMVMSVWGVIFLGLLGVFFYIQAVTLFPDLHFEGHG---KVPSSVIDAK--YNEK 65

Query: 181 AQNCWIAALLYLITLV 228
           A  CWIAA LY +TL+
Sbjct: 66  ATQCWIAAGLYAVTLI 81


>U97593-4|AAB52877.2|   93|Caenorhabditis elegans Hypothetical
           protein C46G7.1 protein.
          Length = 93

 Score = 52.4 bits (120), Expect = 2e-07
 Identities = 25/67 (37%), Positives = 38/67 (56%), Gaps = 1/67 (1%)
 Frame = +1

Query: 19  LVLSVWGIIQLTLMGVFYYIRAVALLEDLPFDEKNPPHSI-EDFVIEVEKGYTLNAQNCW 195
           L L++WG + + ++G  +Y ++V L EDLP + K    S+  D      K Y  NA NCW
Sbjct: 11  LFLALWGTVFMAILGGLFYNQSVGLFEDLPKESKAMEKSLWADRTTNFNKLYQQNAYNCW 70

Query: 196 IAALLYL 216
           IA  +Y+
Sbjct: 71  IACGVYI 77


>AL110478-10|CAE17956.3|  758|Caenorhabditis elegans Hypothetical
           protein Y26D4A.13 protein.
          Length = 758

 Score = 30.3 bits (65), Expect = 1.1
 Identities = 21/74 (28%), Positives = 34/74 (45%)
 Frame = +1

Query: 64  VFYYIRAVALLEDLPFDEKNPPHSIEDFVIEVEKGYTLNAQNCWIAALLYLITLVVSGHQ 243
           V Y+I ++  L D     KN PH       ++    + N +N +   L  L   V +  +
Sbjct: 336 VLYFISSIRYLMDKNISLKNIPHYYFQNYPQIVSNVSTNNKNRFKGGLEKL--HVYANDE 393

Query: 244 FWLKIVPQLVCNIE 285
            + K+ P+LV NIE
Sbjct: 394 LFSKMYPELVVNIE 407


>Z83128-7|CAB05634.2|  243|Caenorhabditis elegans Hypothetical
           protein W01D2.3 protein.
          Length = 243

 Score = 28.3 bits (60), Expect = 4.3
 Identities = 13/35 (37%), Positives = 21/35 (60%)
 Frame = +1

Query: 127 PHSIEDFVIEVEKGYTLNAQNCWIAALLYLITLVV 231
           PHS E    E+E+ +    ++C+  AL  L+TLV+
Sbjct: 81  PHSYELLFREIERVFGRRREHCFYGALGVLLTLVL 115


>U29157-1|AAA68423.4|  675|Caenorhabditis elegans Hypothetical
           protein C34D10.2 protein.
          Length = 675

 Score = 28.3 bits (60), Expect = 4.3
 Identities = 16/40 (40%), Positives = 22/40 (55%), Gaps = 1/40 (2%)
 Frame = -1

Query: 222 CNQVQQCRNPTILCIQGISF-FHFNDEVFDRMRRIFLIKW 106
           C + +QCR P  LC QG +  F+ N +  DR R   L K+
Sbjct: 199 CYKTEQCRKPARLCRQGYACPFYHNSK--DRRRPPALYKY 236


>AF039717-4|AAO21385.1|  303|Caenorhabditis elegans Abnormal dauer
           formation protein16, isoform e protein.
          Length = 303

 Score = 28.3 bits (60), Expect = 4.3
 Identities = 16/41 (39%), Positives = 21/41 (51%), Gaps = 1/41 (2%)
 Frame = +3

Query: 432 YSNY*NIVIVSL-YLSTAGCKPLP*SAQCTILYLSHPIFSS 551
           Y NY N  I  + +LST+   PLP    C I+   H + SS
Sbjct: 220 YGNYQNGGITPINWLSTSNSSPLPGIQSCGIVAAQHTVASS 260


>AF039717-3|AAK82917.1|  530|Caenorhabditis elegans Abnormal dauer
           formation protein16, isoform a protein.
          Length = 530

 Score = 28.3 bits (60), Expect = 4.3
 Identities = 16/41 (39%), Positives = 21/41 (51%), Gaps = 1/41 (2%)
 Frame = +3

Query: 432 YSNY*NIVIVSL-YLSTAGCKPLP*SAQCTILYLSHPIFSS 551
           Y NY N  I  + +LST+   PLP    C I+   H + SS
Sbjct: 447 YGNYQNGGITPINWLSTSNSSPLPGIQSCGIVAAQHTVASS 487


>AF039717-2|AAK82918.1|  508|Caenorhabditis elegans Abnormal dauer
           formation protein16, isoform b protein.
          Length = 508

 Score = 28.3 bits (60), Expect = 4.3
 Identities = 16/41 (39%), Positives = 21/41 (51%), Gaps = 1/41 (2%)
 Frame = +3

Query: 432 YSNY*NIVIVSL-YLSTAGCKPLP*SAQCTILYLSHPIFSS 551
           Y NY N  I  + +LST+   PLP    C I+   H + SS
Sbjct: 425 YGNYQNGGITPINWLSTSNSSPLPGIQSCGIVAAQHTVASS 465


>AF039717-1|AAK82919.1|  510|Caenorhabditis elegans Abnormal dauer
           formation protein16, isoform c protein.
          Length = 510

 Score = 28.3 bits (60), Expect = 4.3
 Identities = 16/41 (39%), Positives = 21/41 (51%), Gaps = 1/41 (2%)
 Frame = +3

Query: 432 YSNY*NIVIVSL-YLSTAGCKPLP*SAQCTILYLSHPIFSS 551
           Y NY N  I  + +LST+   PLP    C I+   H + SS
Sbjct: 427 YGNYQNGGITPINWLSTSNSSPLPGIQSCGIVAAQHTVASS 467


>AF032112-1|AAC47803.1|  510|Caenorhabditis elegans DAF-16 protein.
          Length = 510

 Score = 28.3 bits (60), Expect = 4.3
 Identities = 16/41 (39%), Positives = 21/41 (51%), Gaps = 1/41 (2%)
 Frame = +3

Query: 432 YSNY*NIVIVSL-YLSTAGCKPLP*SAQCTILYLSHPIFSS 551
           Y NY N  I  + +LST+   PLP    C I+   H + SS
Sbjct: 427 YGNYQNGGITPINWLSTSNSSPLPGIQSCGIVAAQHTVASS 467


>AF020344-1|AAB84392.1|  530|Caenorhabditis elegans fork
           head-related transcriptionfactor DAF-16b protein.
          Length = 530

 Score = 28.3 bits (60), Expect = 4.3
 Identities = 16/41 (39%), Positives = 21/41 (51%), Gaps = 1/41 (2%)
 Frame = +3

Query: 432 YSNY*NIVIVSL-YLSTAGCKPLP*SAQCTILYLSHPIFSS 551
           Y NY N  I  + +LST+   PLP    C I+   H + SS
Sbjct: 447 YGNYQNGGITPINWLSTSNSSPLPGIQSCGIVAAQHTVASS 487


>AF020343-1|AAB84391.1|  508|Caenorhabditis elegans fork
           head-related transcriptionfactor DAF-16a2 protein.
          Length = 508

 Score = 28.3 bits (60), Expect = 4.3
 Identities = 16/41 (39%), Positives = 21/41 (51%), Gaps = 1/41 (2%)
 Frame = +3

Query: 432 YSNY*NIVIVSL-YLSTAGCKPLP*SAQCTILYLSHPIFSS 551
           Y NY N  I  + +LST+   PLP    C I+   H + SS
Sbjct: 425 YGNYQNGGITPINWLSTSNSSPLPGIQSCGIVAAQHTVASS 465


>AF020342-1|AAB84390.1|  510|Caenorhabditis elegans fork
           head-related transcriptionfactor DAF-16a1 protein.
          Length = 510

 Score = 28.3 bits (60), Expect = 4.3
 Identities = 16/41 (39%), Positives = 21/41 (51%), Gaps = 1/41 (2%)
 Frame = +3

Query: 432 YSNY*NIVIVSL-YLSTAGCKPLP*SAQCTILYLSHPIFSS 551
           Y NY N  I  + +LST+   PLP    C I+   H + SS
Sbjct: 427 YGNYQNGGITPINWLSTSNSSPLPGIQSCGIVAAQHTVASS 467


>AC006618-3|AAK68251.3|  960|Caenorhabditis elegans Patched related
           family protein 4 protein.
          Length = 960

 Score = 28.3 bits (60), Expect = 4.3
 Identities = 13/41 (31%), Positives = 21/41 (51%), Gaps = 2/41 (4%)
 Frame = +1

Query: 193 WIAALLYLITLVVSGHQFWLKIVP--QLVCNIEGVVIFAVN 309
           W+  + +   + V+ HQFW  IVP    V +I G+    +N
Sbjct: 13  WMQKVFFKYGIFVAKHQFWFLIVPLALTVLSIPGLFYLQIN 53


>U41995-2|AAA83460.1|  317|Caenorhabditis elegans Serpentine
           receptor, class x protein46 protein.
          Length = 317

 Score = 27.9 bits (59), Expect = 5.7
 Identities = 15/50 (30%), Positives = 23/50 (46%)
 Frame = -1

Query: 264 RNDFQPKLMSRYNQCNQVQQCRNPTILCIQGISFFHFNDEVFDRMRRIFL 115
           +ND + K M+    C  VQ C    +  I+ I +F  +  V D   R F+
Sbjct: 200 KNDAKSKQMNSKEICFLVQTCLQGVLFSIELICYFIISPRVEDTWVRFFM 249


>U28738-3|AAA68310.2|  468|Caenorhabditis elegans Hypothetical
           protein T28D9.4 protein.
          Length = 468

 Score = 27.1 bits (57), Expect = 10.0
 Identities = 12/37 (32%), Positives = 22/37 (59%)
 Frame = +1

Query: 43  IQLTLMGVFYYIRAVALLEDLPFDEKNPPHSIEDFVI 153
           +  T++ VF ++  + L + L +  KNPPHS+   V+
Sbjct: 388 VMFTIIAVFRFVFIIILFKVLIY--KNPPHSLTTTVL 422


>AC006795-1|AAF59492.2|  435|Caenorhabditis elegans Hypothetical
           protein Y50D4B.7 protein.
          Length = 435

 Score = 27.1 bits (57), Expect = 10.0
 Identities = 23/71 (32%), Positives = 34/71 (47%), Gaps = 3/71 (4%)
 Frame = +1

Query: 22  VLSVWGIIQLTLMGVFYYIRAVALLE---DLPFDEKNPPHSIEDFVIEVEKGYTLNAQNC 192
           V +V  +   TL  V++ I    LLE   +  FD K+   SIE  VI++E    +   N 
Sbjct: 107 VFNVQRVENRTLGAVYFKILIKGLLELWLEWKFDLKSEGKSIEKIVIKMEGIQEIADGNG 166

Query: 193 WIAALLYLITL 225
            I A  YL+ +
Sbjct: 167 IIKACPYLLNI 177


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 14,023,252
Number of Sequences: 27780
Number of extensions: 287780
Number of successful extensions: 778
Number of sequences better than 10.0: 17
Number of HSP's better than 10.0 without gapping: 749
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 776
length of database: 12,740,198
effective HSP length: 78
effective length of database: 10,573,358
effective search space used: 1247656244
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -