SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30107.Seq
         (684 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z68115-2|CAA92167.1|  914|Caenorhabditis elegans Hypothetical pr...    31   1.0  
U61948-6|AAB03142.1|  497|Caenorhabditis elegans Hypothetical pr...    29   3.1  
Z82268-8|CAB05201.1| 1222|Caenorhabditis elegans Hypothetical pr...    29   4.1  
AL023835-16|CAA19496.1| 1222|Caenorhabditis elegans Hypothetical...    29   4.1  
Z47075-6|CAA87379.1|  538|Caenorhabditis elegans Hypothetical pr...    28   5.4  
U23179-7|AAC46721.1|  782|Caenorhabditis elegans Hypothetical pr...    28   5.4  
AL021572-1|CAA16516.2|  654|Caenorhabditis elegans Hypothetical ...    28   5.4  
AF500111-1|AAM27196.1|  538|Caenorhabditis elegans poly ADP-ribo...    28   5.4  
Z82278-6|CAB05258.1|  690|Caenorhabditis elegans Hypothetical pr...    27   9.4  
U58749-5|AAU05597.1| 1551|Caenorhabditis elegans Hypothetical pr...    27   9.4  
U58749-4|AAU05598.1| 1592|Caenorhabditis elegans Hypothetical pr...    27   9.4  
AF023454-1|AAB82794.1|  707|Caenorhabditis elegans protein phosp...    27   9.4  
AF003389-11|AAC71139.2|  707|Caenorhabditis elegans Phosphatase ...    27   9.4  

>Z68115-2|CAA92167.1|  914|Caenorhabditis elegans Hypothetical
           protein F19H6.3 protein.
          Length = 914

 Score = 30.7 bits (66), Expect = 1.0
 Identities = 21/73 (28%), Positives = 36/73 (49%), Gaps = 1/73 (1%)
 Frame = +2

Query: 191 KSARAGEG-AQKEDQRSRKREQSKPEPKPAKGVTVPTRKGIKETQNVKSXTSKVENNRRV 367
           KSA +  G AQKED   +K  +     K A+  + PTR+  +    +++  SK +    V
Sbjct: 364 KSADSHTGIAQKEDDVEQKTRKKPVRSKLARKRSNPTRRS-ERLSEIQNNASKAQGQEEV 422

Query: 368 RDLHARSIVMLSV 406
            D   +S+++  V
Sbjct: 423 VDTIVKSMLVKEV 435


>U61948-6|AAB03142.1|  497|Caenorhabditis elegans Hypothetical
           protein C46A5.1 protein.
          Length = 497

 Score = 29.1 bits (62), Expect = 3.1
 Identities = 17/59 (28%), Positives = 31/59 (52%)
 Frame = +2

Query: 191 KSARAGEGAQKEDQRSRKREQSKPEPKPAKGVTVPTRKGIKETQNVKSXTSKVENNRRV 367
           K    G G  K+  + + R +SK +PK   G++   RK  K+++  KS  +K +  ++V
Sbjct: 20  KRVHTGNGTAKKHHKRKSRSKSKNKPK--NGLSC-CRKKKKKSKKSKSKVTKKQPKKKV 75


>Z82268-8|CAB05201.1| 1222|Caenorhabditis elegans Hypothetical
           protein Y37A1B.1a protein.
          Length = 1222

 Score = 28.7 bits (61), Expect = 4.1
 Identities = 10/27 (37%), Positives = 18/27 (66%)
 Frame = +2

Query: 200 RAGEGAQKEDQRSRKREQSKPEPKPAK 280
           +A EG +K+D++  KR++ K E +  K
Sbjct: 883 KAAEGEEKKDEKEEKRDEKKDEKREEK 909


>AL023835-16|CAA19496.1| 1222|Caenorhabditis elegans Hypothetical
           protein Y37A1B.1a protein.
          Length = 1222

 Score = 28.7 bits (61), Expect = 4.1
 Identities = 10/27 (37%), Positives = 18/27 (66%)
 Frame = +2

Query: 200 RAGEGAQKEDQRSRKREQSKPEPKPAK 280
           +A EG +K+D++  KR++ K E +  K
Sbjct: 883 KAAEGEEKKDEKEEKRDEKKDEKREEK 909


>Z47075-6|CAA87379.1|  538|Caenorhabditis elegans Hypothetical
           protein E02H1.4 protein.
          Length = 538

 Score = 28.3 bits (60), Expect = 5.4
 Identities = 16/55 (29%), Positives = 31/55 (56%), Gaps = 3/55 (5%)
 Frame = +2

Query: 221 KEDQRSRKREQSKPEPK-PAKGVTVPTRKGI-KETQNVKSXTSKVEN-NRRVRDL 376
           ++ ++  K+E+ +PEPK   K      ++GI KE + +K     VE  N ++++L
Sbjct: 104 RQTEKEVKKEEPEPEPKVDEKNTRGRKKRGIVKEKKEIKKEEEPVEEVNEKLKEL 158


>U23179-7|AAC46721.1|  782|Caenorhabditis elegans Hypothetical
           protein C27D6.1 protein.
          Length = 782

 Score = 28.3 bits (60), Expect = 5.4
 Identities = 11/28 (39%), Positives = 18/28 (64%)
 Frame = +2

Query: 299 RKGIKETQNVKSXTSKVENNRRVRDLHA 382
           RK + E+++V +  S   N+RR+ D HA
Sbjct: 8   RKQVNESESVSNCESTTSNSRRILDQHA 35


>AL021572-1|CAA16516.2|  654|Caenorhabditis elegans Hypothetical
           protein W06H3.1 protein.
          Length = 654

 Score = 28.3 bits (60), Expect = 5.4
 Identities = 14/34 (41%), Positives = 18/34 (52%), Gaps = 1/34 (2%)
 Frame = +2

Query: 257 KP-EPKPAKGVTVPTRKGIKETQNVKSXTSKVEN 355
           KP EPKP K   +  ++ +KET   K    K EN
Sbjct: 97  KPFEPKPVKKELIGVKENLKETTEPKKIEKKPEN 130


>AF500111-1|AAM27196.1|  538|Caenorhabditis elegans poly ADP-ribose
           metabolism enzyme-2 protein.
          Length = 538

 Score = 28.3 bits (60), Expect = 5.4
 Identities = 16/55 (29%), Positives = 31/55 (56%), Gaps = 3/55 (5%)
 Frame = +2

Query: 221 KEDQRSRKREQSKPEPK-PAKGVTVPTRKGI-KETQNVKSXTSKVEN-NRRVRDL 376
           ++ ++  K+E+ +PEPK   K      ++GI KE + +K     VE  N ++++L
Sbjct: 104 RQTEKEVKKEEPEPEPKVDEKNTRGRKKRGIVKEKKEIKKEEEPVEEVNEKLKEL 158


>Z82278-6|CAB05258.1|  690|Caenorhabditis elegans Hypothetical
           protein M162.7 protein.
          Length = 690

 Score = 27.5 bits (58), Expect = 9.4
 Identities = 20/80 (25%), Positives = 35/80 (43%)
 Frame = +2

Query: 311 KETQNVKSXTSKVENNRRVRDLHARSIVMLSVRLRVVVKIGRRTVPQKXGRSSAGHRDAS 490
           KE+ ++KS  S V+N   + DL A    + +V   V+ +I +   P K       H+   
Sbjct: 524 KESASIKSIISSVQNVYGLLDLEAPINQLKNVNSIVLEEIDKAQDPAKLQSQWGDHKADM 583

Query: 491 LAIVGLLQRAPQF*RQQPGR 550
            ++   +  A  F  +  GR
Sbjct: 584 ASLQATMTSAKAFVAELEGR 603


>U58749-5|AAU05597.1| 1551|Caenorhabditis elegans Hypothetical
           protein B0496.3a protein.
          Length = 1551

 Score = 27.5 bits (58), Expect = 9.4
 Identities = 17/52 (32%), Positives = 26/52 (50%), Gaps = 1/52 (1%)
 Frame = +2

Query: 143 QIRSFLGR*DRSS*CVK-SARAGEGAQKEDQRSRKREQSKPEPKPAKGVTVP 295
           QI + LG+  +     K SAR      KE ++ +  EQ   +PK A+G + P
Sbjct: 455 QIENRLGQNKKDKEAAKTSARVETVKLKEVKKEKSPEQQPEDPKTARGTSKP 506


>U58749-4|AAU05598.1| 1592|Caenorhabditis elegans Hypothetical
           protein B0496.3b protein.
          Length = 1592

 Score = 27.5 bits (58), Expect = 9.4
 Identities = 17/52 (32%), Positives = 26/52 (50%), Gaps = 1/52 (1%)
 Frame = +2

Query: 143 QIRSFLGR*DRSS*CVK-SARAGEGAQKEDQRSRKREQSKPEPKPAKGVTVP 295
           QI + LG+  +     K SAR      KE ++ +  EQ   +PK A+G + P
Sbjct: 455 QIENRLGQNKKDKEAAKTSARVETVKLKEVKKEKSPEQQPEDPKTARGTSKP 506


>AF023454-1|AAB82794.1|  707|Caenorhabditis elegans protein
           phosphatase with EF-hands protein.
          Length = 707

 Score = 27.5 bits (58), Expect = 9.4
 Identities = 11/34 (32%), Positives = 21/34 (61%)
 Frame = +3

Query: 483 TRVWRSSAYFNERRNFNDNNQDGAERSRSTKTTA 584
           TR   ++   ++R N+NDNNQ+ +  S + K ++
Sbjct: 20  TRATTTTTSSSQRNNYNDNNQNTSSSSGNKKESS 53


>AF003389-11|AAC71139.2|  707|Caenorhabditis elegans Phosphatase
           with ef hands protein1, isoform a protein.
          Length = 707

 Score = 27.5 bits (58), Expect = 9.4
 Identities = 11/34 (32%), Positives = 21/34 (61%)
 Frame = +3

Query: 483 TRVWRSSAYFNERRNFNDNNQDGAERSRSTKTTA 584
           TR   ++   ++R N+NDNNQ+ +  S + K ++
Sbjct: 20  TRATTTTTSSSQRNNYNDNNQNTSSSSGNKKESS 53


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 12,456,315
Number of Sequences: 27780
Number of extensions: 207675
Number of successful extensions: 729
Number of sequences better than 10.0: 13
Number of HSP's better than 10.0 without gapping: 640
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 712
length of database: 12,740,198
effective HSP length: 79
effective length of database: 10,545,578
effective search space used: 1560745544
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -