SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30104.Seq
         (674 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U50308-3|AAW88404.1| 1392|Caenorhabditis elegans Gut granule los...    31   0.75 
Z82080-8|CAD92382.3|  404|Caenorhabditis elegans Hypothetical pr...    29   3.0  
AL032625-7|CAN86642.1|  404|Caenorhabditis elegans Hypothetical ...    29   3.0  
AL023854-1|CAH60790.2|  404|Caenorhabditis elegans Hypothetical ...    29   3.0  
Z68299-5|CAI46584.1|  111|Caenorhabditis elegans Hypothetical pr...    27   9.2  
AL132862-23|CAB60559.1|  540|Caenorhabditis elegans Hypothetical...    27   9.2  
AL021474-5|CAA16307.2|  673|Caenorhabditis elegans Hypothetical ...    27   9.2  

>U50308-3|AAW88404.1| 1392|Caenorhabditis elegans Gut granule loss
           protein 4 protein.
          Length = 1392

 Score = 31.1 bits (67), Expect = 0.75
 Identities = 10/18 (55%), Positives = 15/18 (83%)
 Frame = +3

Query: 576 CEIKAVAAGRAHTIILTD 629
           C++  +A GRAHT++LTD
Sbjct: 880 CKVTQIACGRAHTVVLTD 897


>Z82080-8|CAD92382.3|  404|Caenorhabditis elegans Hypothetical
           protein W09G3.7a protein.
          Length = 404

 Score = 29.1 bits (62), Expect = 3.0
 Identities = 19/68 (27%), Positives = 34/68 (50%)
 Frame = +2

Query: 356 PMRSSFAERFDITNIACGYGFTVASIKTSEQHKVFGTGINTDSQIGYHSPREIILWNFWL 535
           P R ++     I  I+ G+GF++ + K    ++++G GIN   QIG          ++++
Sbjct: 57  PKRIAYFNTKSIKFISSGFGFSLFASK----NRLYGAGINNRFQIGGQLTNINKYQDYYI 112

Query: 536 SYAPIYIP 559
           S   I IP
Sbjct: 113 SAKKINIP 120


>AL032625-7|CAN86642.1|  404|Caenorhabditis elegans Hypothetical
           protein W09G3.7a protein.
          Length = 404

 Score = 29.1 bits (62), Expect = 3.0
 Identities = 19/68 (27%), Positives = 34/68 (50%)
 Frame = +2

Query: 356 PMRSSFAERFDITNIACGYGFTVASIKTSEQHKVFGTGINTDSQIGYHSPREIILWNFWL 535
           P R ++     I  I+ G+GF++ + K    ++++G GIN   QIG          ++++
Sbjct: 57  PKRIAYFNTKSIKFISSGFGFSLFASK----NRLYGAGINNRFQIGGQLTNINKYQDYYI 112

Query: 536 SYAPIYIP 559
           S   I IP
Sbjct: 113 SAKKINIP 120


>AL023854-1|CAH60790.2|  404|Caenorhabditis elegans Hypothetical
           protein W09G3.7a protein.
          Length = 404

 Score = 29.1 bits (62), Expect = 3.0
 Identities = 19/68 (27%), Positives = 34/68 (50%)
 Frame = +2

Query: 356 PMRSSFAERFDITNIACGYGFTVASIKTSEQHKVFGTGINTDSQIGYHSPREIILWNFWL 535
           P R ++     I  I+ G+GF++ + K    ++++G GIN   QIG          ++++
Sbjct: 57  PKRIAYFNTKSIKFISSGFGFSLFASK----NRLYGAGINNRFQIGGQLTNINKYQDYYI 112

Query: 536 SYAPIYIP 559
           S   I IP
Sbjct: 113 SAKKINIP 120


>Z68299-5|CAI46584.1|  111|Caenorhabditis elegans Hypothetical
          protein T04B2.8 protein.
          Length = 111

 Score = 27.5 bits (58), Expect = 9.2
 Identities = 11/24 (45%), Positives = 15/24 (62%)
 Frame = +3

Query: 24 FALNTLDYYRYNLFFDCGMLGNLI 95
          F L  L+ + +NL F CG LG L+
Sbjct: 6  FGLEALNTFYFNLVFLCGFLGYLV 29


>AL132862-23|CAB60559.1|  540|Caenorhabditis elegans Hypothetical
           protein Y73F8A.30 protein.
          Length = 540

 Score = 27.5 bits (58), Expect = 9.2
 Identities = 13/50 (26%), Positives = 23/50 (46%), Gaps = 3/50 (6%)
 Frame = -2

Query: 358 WMPNQFEVVFVTFFPFLATWEVDT---QSTCLSKSPHMTRLSVLLLIGYW 218
           W P  + ++  T  PF A W  DT    S  +++      ++V++   YW
Sbjct: 63  WNPYLYGMINTTILPFDAIWLPDTYLYNSVVMNREETERYINVVVTTNYW 112


>AL021474-5|CAA16307.2|  673|Caenorhabditis elegans Hypothetical
           protein Y32F6A.2 protein.
          Length = 673

 Score = 27.5 bits (58), Expect = 9.2
 Identities = 10/29 (34%), Positives = 15/29 (51%)
 Frame = +2

Query: 470 INTDSQIGYHSPREIILWNFWLSYAPIYI 556
           +N  + IG H P  +  W  WL  +PI +
Sbjct: 556 VNIRAMIGGHGPPNVFWWLNWLVISPILL 584


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 15,698,302
Number of Sequences: 27780
Number of extensions: 323847
Number of successful extensions: 938
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 796
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 938
length of database: 12,740,198
effective HSP length: 79
effective length of database: 10,545,578
effective search space used: 1529108810
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -