SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30102.Seq
         (594 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF025460-6|AAB70989.1|  130|Caenorhabditis elegans Ribosomal pro...   130   7e-31
U00032-8|AAA50632.2| 1163|Caenorhabditis elegans Hypothetical pr...    28   4.4  
AL132860-21|CAB60518.2|  759|Caenorhabditis elegans Hypothetical...    28   5.8  
AF057032-1|AAC13567.1|  759|Caenorhabditis elegans DNA topoisome...    28   5.8  
U41547-3|AAA83193.2|  145|Caenorhabditis elegans Hypothetical pr...    27   7.6  

>AF025460-6|AAB70989.1|  130|Caenorhabditis elegans Ribosomal
           protein, small subunitprotein 22 protein.
          Length = 130

 Score =  130 bits (314), Expect = 7e-31
 Identities = 65/76 (85%), Positives = 70/76 (92%), Gaps = 2/76 (2%)
 Frame = -3

Query: 463 MVRMNVLSDALKSIHNAEKRGKRQVLIRPCSKVIVKFLTVMMXHGYIGEFEIVDDHRAGK 284
           MVRMNVL+DAL +I+NAEKRGKRQVLIRP SKVIV+FLTVMM HGYIGEFEIVDDHRAGK
Sbjct: 1   MVRMNVLADALNAINNAEKRGKRQVLIRPASKVIVRFLTVMMKHGYIGEFEIVDDHRAGK 60

Query: 283 IVVNLTGRLK--SVVS 242
           IVVNLTGRL   SV+S
Sbjct: 61  IVVNLTGRLNKASVIS 76



 Score = 72.1 bits (169), Expect = 3e-13
 Identities = 33/48 (68%), Positives = 40/48 (83%), Gaps = 1/48 (2%)
 Frame = -2

Query: 254 KCGVISPRFDVPINDIERWTN-LLPSRQFGYLVLXTSGGIMXHEEARR 114
           K  VISPR ++ +ND+E++TN LLPSRQFGYL+L TS GIM HEEARR
Sbjct: 71  KASVISPRLNIRLNDLEKYTNTLLPSRQFGYLILTTSAGIMDHEEARR 118


>U00032-8|AAA50632.2| 1163|Caenorhabditis elegans Hypothetical protein
            F37A4.4 protein.
          Length = 1163

 Score = 28.3 bits (60), Expect = 4.4
 Identities = 21/62 (33%), Positives = 29/62 (46%), Gaps = 2/62 (3%)
 Frame = -3

Query: 451  NVLSDALKSIH--NAEKRGKRQVLIRPCSKVIVKFLTVMMXHGYIGEFEIVDDHRAGKIV 278
            NVL D+++ I+  N  K  KR   I  C+K     L V    GY    EI+  H A +  
Sbjct: 826  NVLIDSVREINATNLLKAVKRGAYINVCNKYGNTALHVATRRGYQNLVEILIKHGADRSF 885

Query: 277  VN 272
            +N
Sbjct: 886  LN 887


>AL132860-21|CAB60518.2|  759|Caenorhabditis elegans Hypothetical
           protein Y56A3A.27 protein.
          Length = 759

 Score = 27.9 bits (59), Expect = 5.8
 Identities = 17/67 (25%), Positives = 31/67 (46%)
 Frame = -3

Query: 526 ELGTGPPXQFGSLRSAS*ILAMVRMNVLSDALKSIHNAEKRGKRQVLIRPCSKVIVKFLT 347
           ++G G       L  A  I  M +  + +DA  + H  + + +  + +RP  K+I  FL 
Sbjct: 479 KIGDGKTQAPDFLTEADLISLMDKYGIGTDATHAEHIEKIKTREYIGVRPDGKLIPSFLG 538

Query: 346 VMMXHGY 326
           + +  GY
Sbjct: 539 LALVDGY 545


>AF057032-1|AAC13567.1|  759|Caenorhabditis elegans DNA
           topoisomerase III protein.
          Length = 759

 Score = 27.9 bits (59), Expect = 5.8
 Identities = 17/67 (25%), Positives = 31/67 (46%)
 Frame = -3

Query: 526 ELGTGPPXQFGSLRSAS*ILAMVRMNVLSDALKSIHNAEKRGKRQVLIRPCSKVIVKFLT 347
           ++G G       L  A  I  M +  + +DA  + H  + + +  + +RP  K+I  FL 
Sbjct: 479 KIGDGKTQAPDFLTEADLISLMDKYGIGTDATHAEHIEKIKTREYIGVRPDGKLIPSFLG 538

Query: 346 VMMXHGY 326
           + +  GY
Sbjct: 539 LALVDGY 545


>U41547-3|AAA83193.2|  145|Caenorhabditis elegans Hypothetical
           protein F22A3.2 protein.
          Length = 145

 Score = 27.5 bits (58), Expect = 7.6
 Identities = 13/45 (28%), Positives = 25/45 (55%)
 Frame = +2

Query: 260 SACEIYNNLASSVIINDFKLSDVTVXHHHC*KLNDDFGTGPDEDL 394
           +A E ++   +  +   F+  +V V +     ++DDFG+ PD+DL
Sbjct: 18  AASESHSGRQNYRVKGAFRCGNVPVKNVQVKLIDDDFGSDPDDDL 62


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 10,800,274
Number of Sequences: 27780
Number of extensions: 193520
Number of successful extensions: 379
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 376
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 378
length of database: 12,740,198
effective HSP length: 78
effective length of database: 10,573,358
effective search space used: 1258229602
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -