SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30099.Seq
         (730 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U51994-6|AAA96068.1|  463|Caenorhabditis elegans Elongation fact...   207   7e-54
U40935-2|AAA81688.1|  463|Caenorhabditis elegans Elongation fact...   207   7e-54
U51994-9|AAO21383.1|  267|Caenorhabditis elegans Elongation fact...   146   2e-35
U51994-7|AAO21384.1|  429|Caenorhabditis elegans Elongation fact...   146   2e-35
U51994-8|AAO21382.1|   77|Caenorhabditis elegans Elongation fact...   138   3e-33
Z81098-7|CAI79193.2|  592|Caenorhabditis elegans Hypothetical pr...   120   1e-27
Z81098-6|CAB03180.3|  610|Caenorhabditis elegans Hypothetical pr...   120   1e-27
Z92835-1|CAB07395.2|  532|Caenorhabditis elegans Hypothetical pr...   118   4e-27
U80437-9|AAN84843.1|  439|Caenorhabditis elegans Tu elongation f...    70   2e-12
AB010028-1|BAA31345.1|  439|Caenorhabditis elegans mitochondrial...    70   2e-12
D38472-1|BAA07492.1|  495|Caenorhabditis elegans elongation fact...    66   2e-11
D38471-1|BAA07491.1|  496|Caenorhabditis elegans elongation fact...    66   2e-11
AC024859-25|AAK29979.1|  496|Caenorhabditis elegans Tu elongatio...    66   2e-11
Z99709-7|CAB16862.2|  500|Caenorhabditis elegans Hypothetical pr...    45   6e-05
Z70780-15|CAA94822.2|  702|Caenorhabditis elegans Hypothetical p...    40   0.001
AC025716-9|AAK39619.1|  469|Caenorhabditis elegans Hypothetical ...    35   0.052
L13200-4|AAA28191.2|  645|Caenorhabditis elegans Hypothetical pr...    35   0.068
AC006714-2|AAK29716.2|  689|Caenorhabditis elegans Hypothetical ...    34   0.091
AC024817-55|AAF59563.3|  366|Caenorhabditis elegans Hypothetical...    33   0.16 
Z81519-1|CAB04216.1|  750|Caenorhabditis elegans Hypothetical pr...    33   0.21 
Z81068-5|CAB02985.1|  852|Caenorhabditis elegans Hypothetical pr...    33   0.28 
M86959-1|AAD03339.1|  852|Caenorhabditis elegans elongation fact...    33   0.28 
L40996-1|AAA86431.1|  593|Caenorhabditis elegans GTP-binding pro...    31   0.84 
AF125969-2|AAD14761.1|  613|Caenorhabditis elegans Caenorhabditi...    31   0.84 
AC024808-3|AAK29925.1|  183|Caenorhabditis elegans Hypothetical ...    31   0.84 
U50193-2|AAA91248.1|  974|Caenorhabditis elegans Elongation fact...    30   1.5  
M86958-1|AAA21824.1|  849|Caenorhabditis elegans eft-1 protein.        30   1.5  
DQ867020-1|ABI49097.1| 1074|Caenorhabditis elegans eukaryotic tr...    30   1.9  
Z66513-12|CAI46602.1|  492|Caenorhabditis elegans Hypothetical p...    29   2.6  
Z66513-11|CAA91332.3|  427|Caenorhabditis elegans Hypothetical p...    29   2.6  
Z99709-6|CAB16863.1|  459|Caenorhabditis elegans Hypothetical pr...    29   4.5  
Z75710-2|CAB00025.2|  381|Caenorhabditis elegans Hypothetical pr...    28   7.9  
Z47808-7|CAA87771.2|  934|Caenorhabditis elegans Hypothetical pr...    28   7.9  
S75262-1|AAC60520.1|  332|Caenorhabditis elegans p34cdc2 kinase ...    28   7.9  

>U51994-6|AAA96068.1|  463|Caenorhabditis elegans Elongation factor
           protein 4, isoforma protein.
          Length = 463

 Score =  207 bits (505), Expect = 7e-54
 Identities = 101/141 (71%), Positives = 111/141 (78%)
 Frame = +2

Query: 257 KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 436
           KFET+KYY+TIIDAPGHRDFIKNMITGTSQADCAVL+VA GTGEFEAGISKNGQTREHAL
Sbjct: 79  KFETAKYYITIIDAPGHRDFIKNMITGTSQADCAVLVVACGTGEFEAGISKNGQTREHAL 138

Query: 437 LAFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHG 616
           LA TLGVKQLIV  NKMDSTEPP+      +   +     KKIGYNP AV FVPISG++G
Sbjct: 139 LAQTLGVKQLIVACNKMDSTEPPFSEARFTEITNEVSGFIKKIGYNPKAVPFVPISGFNG 198

Query: 617 DNMLELQPKCLGSRDGQVERK 679
           DNMLE+       +   VERK
Sbjct: 199 DNMLEVSSNMPWFKGWAVERK 219



 Score =  146 bits (353), Expect = 2e-35
 Identities = 67/68 (98%), Positives = 67/68 (98%)
 Frame = +1

Query: 25  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 204
           MGKEK HINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL
Sbjct: 1   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 60

Query: 205 DKLKAERE 228
           DKLKAERE
Sbjct: 61  DKLKAERE 68


>U40935-2|AAA81688.1|  463|Caenorhabditis elegans Elongation factor
           protein 3 protein.
          Length = 463

 Score =  207 bits (505), Expect = 7e-54
 Identities = 101/141 (71%), Positives = 111/141 (78%)
 Frame = +2

Query: 257 KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 436
           KFET+KYY+TIIDAPGHRDFIKNMITGTSQADCAVL+VA GTGEFEAGISKNGQTREHAL
Sbjct: 79  KFETAKYYITIIDAPGHRDFIKNMITGTSQADCAVLVVACGTGEFEAGISKNGQTREHAL 138

Query: 437 LAFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHG 616
           LA TLGVKQLIV  NKMDSTEPP+      +   +     KKIGYNP AV FVPISG++G
Sbjct: 139 LAQTLGVKQLIVACNKMDSTEPPFSEARFTEITNEVSGFIKKIGYNPKAVPFVPISGFNG 198

Query: 617 DNMLELQPKCLGSRDGQVERK 679
           DNMLE+       +   VERK
Sbjct: 199 DNMLEVSSNMPWFKGWAVERK 219



 Score =  146 bits (353), Expect = 2e-35
 Identities = 67/68 (98%), Positives = 67/68 (98%)
 Frame = +1

Query: 25  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 204
           MGKEK HINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL
Sbjct: 1   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 60

Query: 205 DKLKAERE 228
           DKLKAERE
Sbjct: 61  DKLKAERE 68


>U51994-9|AAO21383.1|  267|Caenorhabditis elegans Elongation factor
           protein 4, isoformc protein.
          Length = 267

 Score =  146 bits (353), Expect = 2e-35
 Identities = 67/68 (98%), Positives = 67/68 (98%)
 Frame = +1

Query: 25  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 204
           MGKEK HINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL
Sbjct: 1   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 60

Query: 205 DKLKAERE 228
           DKLKAERE
Sbjct: 61  DKLKAERE 68



 Score =  141 bits (341), Expect = 5e-34
 Identities = 65/71 (91%), Positives = 69/71 (97%)
 Frame = +2

Query: 257 KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 436
           KFET+KYY+TIIDAPGHRDFIKNMITGTSQADCAVL+VA GTGEFEAGISKNGQTREHAL
Sbjct: 79  KFETAKYYITIIDAPGHRDFIKNMITGTSQADCAVLVVACGTGEFEAGISKNGQTREHAL 138

Query: 437 LAFTLGVKQLI 469
           LA TLGVKQL+
Sbjct: 139 LAQTLGVKQLV 149


>U51994-7|AAO21384.1|  429|Caenorhabditis elegans Elongation factor
           protein 4, isoformd protein.
          Length = 429

 Score =  146 bits (353), Expect = 2e-35
 Identities = 67/68 (98%), Positives = 67/68 (98%)
 Frame = +1

Query: 25  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 204
           MGKEK HINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL
Sbjct: 1   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 60

Query: 205 DKLKAERE 228
           DKLKAERE
Sbjct: 61  DKLKAERE 68



 Score = 83.0 bits (196), Expect(2) = 6e-32
 Identities = 36/39 (92%), Positives = 39/39 (100%)
 Frame = +2

Query: 257 KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVA 373
           KFET+KYY+TIIDAPGHRDFIKNMITGTSQADCAVL+VA
Sbjct: 79  KFETAKYYITIIDAPGHRDFIKNMITGTSQADCAVLVVA 117



 Score = 72.5 bits (170), Expect(2) = 6e-32
 Identities = 36/72 (50%), Positives = 44/72 (61%)
 Frame = +2

Query: 464 LIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHGDNMLELQPK 643
           L+V  NKMDSTEPP+      +   +     KKIGYNP AV FVPISG++GDNMLE+   
Sbjct: 114 LVVACNKMDSTEPPFSEARFTEITNEVSGFIKKIGYNPKAVPFVPISGFNGDNMLEVSSN 173

Query: 644 CLGSRDGQVERK 679
               +   VERK
Sbjct: 174 MPWFKGWAVERK 185


>U51994-8|AAO21382.1|   77|Caenorhabditis elegans Elongation factor
           protein 4, isoformb protein.
          Length = 77

 Score =  138 bits (335), Expect = 3e-33
 Identities = 63/67 (94%), Positives = 64/67 (95%)
 Frame = +1

Query: 25  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 204
           MGKEK HINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL
Sbjct: 1   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 60

Query: 205 DKLKAER 225
           DKLK  +
Sbjct: 61  DKLKVTK 67


>Z81098-7|CAI79193.2|  592|Caenorhabditis elegans Hypothetical
           protein K07A12.4b protein.
          Length = 592

 Score =  120 bits (288), Expect = 1e-27
 Identities = 62/124 (50%), Positives = 84/124 (67%)
 Frame = +2

Query: 260 FETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALL 439
           FETS   + ++DAPGH+DFI NMITGTSQAD A+L+V A TGEFE G    GQT+EHALL
Sbjct: 243 FETSHRRIVLLDAPGHKDFISNMITGTSQADAAILVVNATTGEFETGFENGGQTKEHALL 302

Query: 440 AFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHGD 619
             +LGV QLIV VNK+D+ +      D  K+      T ++ G++     FVP+SG+ G+
Sbjct: 303 LRSLGVTQLIVAVNKLDTVDWSQDRFDEIKNNLSVFLT-RQAGFSKP--KFVPVSGFTGE 359

Query: 620 NMLE 631
           N+++
Sbjct: 360 NLIK 363



 Score = 83.0 bits (196), Expect = 2e-16
 Identities = 36/65 (55%), Positives = 48/65 (73%)
 Frame = +1

Query: 34  EKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKL 213
           +K  IN++V+GHVD+GKST  GHL++    +D RTI+KF+ EA   GK SF YAWVLD+ 
Sbjct: 167 DKDLINLIVVGHVDAGKSTLMGHLLHDLEVVDSRTIDKFKHEAARNGKASFAYAWVLDET 226

Query: 214 KAERE 228
           + ERE
Sbjct: 227 EEERE 231


>Z81098-6|CAB03180.3|  610|Caenorhabditis elegans Hypothetical
           protein K07A12.4a protein.
          Length = 610

 Score =  120 bits (288), Expect = 1e-27
 Identities = 62/124 (50%), Positives = 84/124 (67%)
 Frame = +2

Query: 260 FETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALL 439
           FETS   + ++DAPGH+DFI NMITGTSQAD A+L+V A TGEFE G    GQT+EHALL
Sbjct: 261 FETSHRRIVLLDAPGHKDFISNMITGTSQADAAILVVNATTGEFETGFENGGQTKEHALL 320

Query: 440 AFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHGD 619
             +LGV QLIV VNK+D+ +      D  K+      T ++ G++     FVP+SG+ G+
Sbjct: 321 LRSLGVTQLIVAVNKLDTVDWSQDRFDEIKNNLSVFLT-RQAGFSKP--KFVPVSGFTGE 377

Query: 620 NMLE 631
           N+++
Sbjct: 378 NLIK 381



 Score = 83.0 bits (196), Expect = 2e-16
 Identities = 36/65 (55%), Positives = 48/65 (73%)
 Frame = +1

Query: 34  EKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKL 213
           +K  IN++V+GHVD+GKST  GHL++    +D RTI+KF+ EA   GK SF YAWVLD+ 
Sbjct: 185 DKDLINLIVVGHVDAGKSTLMGHLLHDLEVVDSRTIDKFKHEAARNGKASFAYAWVLDET 244

Query: 214 KAERE 228
           + ERE
Sbjct: 245 EEERE 249


>Z92835-1|CAB07395.2|  532|Caenorhabditis elegans Hypothetical
           protein H19N07.1 protein.
          Length = 532

 Score =  118 bits (284), Expect = 4e-27
 Identities = 55/120 (45%), Positives = 76/120 (63%), Gaps = 1/120 (0%)
 Frame = +2

Query: 260 FETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALL 439
           FET K + TI+DAPGH+ F+ NMI G +QAD AVL+++A  GEFE G  + GQTREH++L
Sbjct: 182 FETEKRHFTILDAPGHKSFVPNMIVGANQADLAVLVISARRGEFETGFDRGGQTREHSML 241

Query: 440 AFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAA-VAFVPISGWHG 616
             T GVK L++ VNKMD     +     ++   K     +K+G+NP   + +VP SG  G
Sbjct: 242 VKTAGVKHLVILVNKMDDPTVKWEEERFKEIEGKLTPFLRKLGFNPKTDITYVPCSGLTG 301



 Score = 79.0 bits (186), Expect = 3e-15
 Identities = 34/67 (50%), Positives = 48/67 (71%)
 Frame = +1

Query: 28  GKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLD 207
           G  K HIN+V +GHVD+GKST  G L++  G +DKRT+EK+E+EA+E G+ S+  +W +D
Sbjct: 104 GTHKEHINMVFVGHVDAGKSTIGGQLMFLTGMVDKRTLEKYEREAKEKGRESWYLSWCMD 163

Query: 208 KLKAERE 228
               ERE
Sbjct: 164 TNDEERE 170


>U80437-9|AAN84843.1|  439|Caenorhabditis elegans Tu elongation
           factor (ef-tu), mitochondrialprotein 2 protein.
          Length = 439

 Score = 69.7 bits (163), Expect = 2e-12
 Identities = 36/69 (52%), Positives = 44/69 (63%)
 Frame = +2

Query: 293 DAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIV 472
           D PGH DFIKNMI GTSQ D AVL++AA  G  E       QT+EH +LA  +GVK + +
Sbjct: 114 DCPGHSDFIKNMICGTSQMDVAVLVIAATDGVME-------QTKEHLILAKQVGVKNMAI 166

Query: 473 GVNKMDSTE 499
            +NK D  E
Sbjct: 167 FINKADLVE 175



 Score = 28.7 bits (61), Expect = 4.5
 Identities = 10/20 (50%), Positives = 15/20 (75%)
 Frame = +1

Query: 37  KTHINIVVIGHVDSGKSTTT 96
           K ++N+  IGH+D GK+T T
Sbjct: 43  KINVNVGTIGHIDHGKTTLT 62


>AB010028-1|BAA31345.1|  439|Caenorhabditis elegans mitochondrial
           elongation factorTu homologue protein.
          Length = 439

 Score = 69.7 bits (163), Expect = 2e-12
 Identities = 36/69 (52%), Positives = 44/69 (63%)
 Frame = +2

Query: 293 DAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIV 472
           D PGH DFIKNMI GTSQ D AVL++AA  G  E       QT+EH +LA  +GVK + +
Sbjct: 114 DCPGHSDFIKNMICGTSQMDVAVLVIAATDGVME-------QTKEHLILAKQVGVKNMAI 166

Query: 473 GVNKMDSTE 499
            +NK D  E
Sbjct: 167 FINKADLVE 175



 Score = 28.7 bits (61), Expect = 4.5
 Identities = 10/20 (50%), Positives = 15/20 (75%)
 Frame = +1

Query: 37  KTHINIVVIGHVDSGKSTTT 96
           K ++N+  IGH+D GK+T T
Sbjct: 43  KINVNVGTIGHIDHGKTTLT 62


>D38472-1|BAA07492.1|  495|Caenorhabditis elegans elongation factor
           Tu homologueprecursor protein.
          Length = 495

 Score = 66.5 bits (155), Expect = 2e-11
 Identities = 37/80 (46%), Positives = 51/80 (63%), Gaps = 2/80 (2%)
 Frame = +2

Query: 257 KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 436
           ++ET+K +   ID PGH D+IKNMITG +Q + A+L+VAA  G          QTREH L
Sbjct: 106 EYETAKRHYAHIDCPGHADYIKNMITGAAQMEGAILVVAATDGPMP-------QTREHLL 158

Query: 437 LAFTLGV--KQLIVGVNKMD 490
           LA  +GV    ++V +NK+D
Sbjct: 159 LARQVGVPLDNIVVFMNKVD 178



 Score = 36.3 bits (80), Expect = 0.022
 Identities = 21/68 (30%), Positives = 34/68 (50%), Gaps = 3/68 (4%)
 Frame = +1

Query: 31  KEKTHINIVVIGHVDSGKSTTTG---HLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWV 201
           ++K H+N+  IGHVD GK+T T     ++    G   R  E  +   +E  +G    A+ 
Sbjct: 45  RDKPHLNVGTIGHVDHGKTTLTSAITKILATSKGAKYRKYEDIDNAPEEKARGITINAFH 104

Query: 202 LDKLKAER 225
           L+   A+R
Sbjct: 105 LEYETAKR 112


>D38471-1|BAA07491.1|  496|Caenorhabditis elegans elongation factor
           Tu homologueprecursor protein.
          Length = 496

 Score = 66.5 bits (155), Expect = 2e-11
 Identities = 37/80 (46%), Positives = 51/80 (63%), Gaps = 2/80 (2%)
 Frame = +2

Query: 257 KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 436
           ++ET+K +   ID PGH D+IKNMITG +Q + A+L+VAA  G          QTREH L
Sbjct: 107 EYETAKRHYAHIDCPGHADYIKNMITGAAQMEGAILVVAATDGPMP-------QTREHLL 159

Query: 437 LAFTLGV--KQLIVGVNKMD 490
           LA  +GV    ++V +NK+D
Sbjct: 160 LARQVGVPLDNIVVFMNKVD 179



 Score = 36.3 bits (80), Expect = 0.022
 Identities = 21/68 (30%), Positives = 34/68 (50%), Gaps = 3/68 (4%)
 Frame = +1

Query: 31  KEKTHINIVVIGHVDSGKSTTTG---HLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWV 201
           ++K H+N+  IGHVD GK+T T     ++    G   R  E  +   +E  +G    A+ 
Sbjct: 46  RDKPHLNVGTIGHVDHGKTTLTSAITKILATSKGAKYRKYEDIDNAPEEKARGITINAFH 105

Query: 202 LDKLKAER 225
           L+   A+R
Sbjct: 106 LEYETAKR 113


>AC024859-25|AAK29979.1|  496|Caenorhabditis elegans Tu elongation
           factor (ef-tu), mitochondrialprotein 1 protein.
          Length = 496

 Score = 66.5 bits (155), Expect = 2e-11
 Identities = 37/80 (46%), Positives = 51/80 (63%), Gaps = 2/80 (2%)
 Frame = +2

Query: 257 KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 436
           ++ET+K +   ID PGH D+IKNMITG +Q + A+L+VAA  G          QTREH L
Sbjct: 107 EYETAKRHYAHIDCPGHADYIKNMITGAAQMEGAILVVAATDGPMP-------QTREHLL 159

Query: 437 LAFTLGV--KQLIVGVNKMD 490
           LA  +GV    ++V +NK+D
Sbjct: 160 LARQVGVPLDNIVVFMNKVD 179



 Score = 36.3 bits (80), Expect = 0.022
 Identities = 21/68 (30%), Positives = 34/68 (50%), Gaps = 3/68 (4%)
 Frame = +1

Query: 31  KEKTHINIVVIGHVDSGKSTTTG---HLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWV 201
           ++K H+N+  IGHVD GK+T T     ++    G   R  E  +   +E  +G    A+ 
Sbjct: 46  RDKPHLNVGTIGHVDHGKTTLTSAITKILATSKGAKYRKYEDIDNAPEEKARGITINAFH 105

Query: 202 LDKLKAER 225
           L+   A+R
Sbjct: 106 LEYETAKR 113


>Z99709-7|CAB16862.2|  500|Caenorhabditis elegans Hypothetical
           protein C47B2.7b protein.
          Length = 500

 Score = 44.8 bits (101), Expect = 6e-05
 Identities = 27/86 (31%), Positives = 45/86 (52%)
 Frame = +2

Query: 281 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVK 460
           + +ID PGH   I+ ++  ++  D A++I+     +  AGI    QT EH LLA      
Sbjct: 74  LALIDCPGHSGLIRAVLAASTVFDMAIVII-----DVVAGIQP--QTAEHLLLASKFCPN 126

Query: 461 QLIVGVNKMDSTEPPYVSPDLRKSRR 538
           ++I+ +NK D  E   +S   +K R+
Sbjct: 127 RVIIVLNKCDLAEKSKISESAKKVRK 152



 Score = 28.7 bits (61), Expect = 4.5
 Identities = 10/17 (58%), Positives = 15/17 (88%)
 Frame = +1

Query: 46 INIVVIGHVDSGKSTTT 96
          +N+ ++GHVDSGK+T T
Sbjct: 14 LNLGILGHVDSGKTTLT 30


>Z70780-15|CAA94822.2|  702|Caenorhabditis elegans Hypothetical
           protein F46B6.6a protein.
          Length = 702

 Score = 40.3 bits (90), Expect = 0.001
 Identities = 42/129 (32%), Positives = 53/129 (41%), Gaps = 2/129 (1%)
 Frame = +2

Query: 281 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVK 460
           VT +D PGH  F      G   AD  VL+VAA  G  E       QT +    A    V 
Sbjct: 206 VTFLDTPGHAAFASMRARGAKGADIVVLVVAADDGVKE-------QTAQSIKFAKDANV- 257

Query: 461 QLIVGVNKMDSTEPPYVSPDLRKSRRKYPH--TFKKIGYNPAAVAFVPISGWHGDNMLEL 634
           QL+V VNK+D    P   P +R  R    H    +++G     V  V +S     N+  L
Sbjct: 258 QLVVAVNKIDK---PNADP-MRAMRSLLEHDVVVEQLG---GDVQCVEVSALQSRNLPSL 310

Query: 635 QPKCLGSRD 661
           Q   L   D
Sbjct: 311 QDALLLQAD 319


>AC025716-9|AAK39619.1|  469|Caenorhabditis elegans Hypothetical
           protein Y39G10AR.8 protein.
          Length = 469

 Score = 35.1 bits (77), Expect = 0.052
 Identities = 23/81 (28%), Positives = 36/81 (44%)
 Frame = +2

Query: 248 CSRKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTRE 427
           C  +F T   +V+ +D PGH   +  M+ G +  D A L+VA              QT E
Sbjct: 119 CGGEF-TCVRHVSFVDCPGHDILMATMLNGAAVMDAAFLLVAGNEP------CPQPQTSE 171

Query: 428 HALLAFTLGVKQLIVGVNKMD 490
           H      + +  L++  NK+D
Sbjct: 172 HLAAVEIMQLNHLMILQNKVD 192


>L13200-4|AAA28191.2|  645|Caenorhabditis elegans Hypothetical
           protein ZK1236.1 protein.
          Length = 645

 Score = 34.7 bits (76), Expect = 0.068
 Identities = 24/72 (33%), Positives = 35/72 (48%)
 Frame = +2

Query: 275 YYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLG 454
           Y + +ID PGH DF   +    +  D  +L+VAA  G          QT  +  LAF   
Sbjct: 102 YLLNLIDTPGHVDFSAEVSRSLAVCDGILLLVAANQG-------VQAQTIANFWLAFEKN 154

Query: 455 VKQLIVGVNKMD 490
           + Q+I  +NK+D
Sbjct: 155 I-QIIPVINKID 165



 Score = 32.3 bits (70), Expect = 0.37
 Identities = 14/42 (33%), Positives = 23/42 (54%), Gaps = 3/42 (7%)
 Frame = +1

Query: 49  NIVVIGHVDSGKSTTTGHLIYKCGGI---DKRTIEKFEKEAQ 165
           N  ++ HVD GKST    L+  CG +    K+ ++K + E +
Sbjct: 44  NFGIVAHVDHGKSTLADRLLEMCGAVPPGQKQMLDKLQVERE 85


>AC006714-2|AAK29716.2|  689|Caenorhabditis elegans Hypothetical
           protein Y119D3B.14 protein.
          Length = 689

 Score = 34.3 bits (75), Expect = 0.091
 Identities = 15/26 (57%), Positives = 18/26 (69%)
 Frame = +1

Query: 49  NIVVIGHVDSGKSTTTGHLIYKCGGI 126
           NI VI HVD+GK+T T  L+Y  G I
Sbjct: 27  NIGVIAHVDAGKTTVTERLLYLAGAI 52


>AC024817-55|AAF59563.3|  366|Caenorhabditis elegans Hypothetical
           protein Y54G2A.28 protein.
          Length = 366

 Score = 33.5 bits (73), Expect = 0.16
 Identities = 18/43 (41%), Positives = 24/43 (55%)
 Frame = -2

Query: 483 LFTPTMSCLTPRVKASKACSRV*PFLEIPASNSPVPAATMSTA 355
           LF PT+SC+  +  AS   S   P +  PA N  VP AT+S +
Sbjct: 13  LFDPTLSCMATQNSASATLSCANPTVAAPA-NDDVPEATLSVS 54


>Z81519-1|CAB04216.1|  750|Caenorhabditis elegans Hypothetical
           protein F29C12.4 protein.
          Length = 750

 Score = 33.1 bits (72), Expect = 0.21
 Identities = 13/27 (48%), Positives = 18/27 (66%)
 Frame = +1

Query: 49  NIVVIGHVDSGKSTTTGHLIYKCGGID 129
           NI +  H+DSGK+T T  ++Y  G ID
Sbjct: 46  NIGISAHIDSGKTTVTERILYYAGRID 72



 Score = 28.3 bits (60), Expect = 5.9
 Identities = 23/70 (32%), Positives = 30/70 (42%)
 Frame = +2

Query: 281 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVK 460
           + IID PGH DF   +       D AVL++  G G    G+     T    L  + +   
Sbjct: 114 INIIDTPGHVDFTVEVERALRVLDGAVLVL-CGVG----GVQSQTFTVNRQLARYNV--- 165

Query: 461 QLIVGVNKMD 490
             I  VNKMD
Sbjct: 166 PFICFVNKMD 175


>Z81068-5|CAB02985.1|  852|Caenorhabditis elegans Hypothetical
           protein F25H5.4 protein.
          Length = 852

 Score = 32.7 bits (71), Expect = 0.28
 Identities = 15/32 (46%), Positives = 20/32 (62%)
 Frame = +1

Query: 25  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCG 120
           M +++   N+ VI HVD GKST T  L+ K G
Sbjct: 13  MDRKRNIRNMSVIAHVDHGKSTLTDSLVSKAG 44



 Score = 29.1 bits (62), Expect = 3.4
 Identities = 12/44 (27%), Positives = 24/44 (54%)
 Frame = +2

Query: 254 RKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 385
           +K + + + + +ID+PGH DF   +       D A+++V   +G
Sbjct: 103 KKEKYNGFLINLIDSPGHVDFSSEVTAALRVTDGALVVVDCVSG 146


>M86959-1|AAD03339.1|  852|Caenorhabditis elegans elongation factor
           protein.
          Length = 852

 Score = 32.7 bits (71), Expect = 0.28
 Identities = 15/32 (46%), Positives = 20/32 (62%)
 Frame = +1

Query: 25  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCG 120
           M +++   N+ VI HVD GKST T  L+ K G
Sbjct: 13  MDRKRNIRNMSVIAHVDHGKSTLTDSLVSKAG 44



 Score = 29.5 bits (63), Expect = 2.6
 Identities = 12/44 (27%), Positives = 24/44 (54%)
 Frame = +2

Query: 254 RKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 385
           +K + + + + +ID+PGH DF   +       D A+++V   +G
Sbjct: 103 KKEKYNGFLINLIDSPGHVDFSSEVTAALGVTDGALVVVDCVSG 146


>L40996-1|AAA86431.1|  593|Caenorhabditis elegans GTP-binding
           protein protein.
          Length = 593

 Score = 31.1 bits (67), Expect = 0.84
 Identities = 15/37 (40%), Positives = 23/37 (62%)
 Frame = +1

Query: 1   FVIRD*PKMGKEKTHINIVVIGHVDSGKSTTTGHLIY 111
           ++IRD P   K+     + V+G+VD+GKST  G L +
Sbjct: 127 WIIRD-PPTEKDFIEARVAVVGNVDAGKSTLLGVLTH 162


>AF125969-2|AAD14761.1|  613|Caenorhabditis elegans Caenorhabditis
           gtp-binding proteinprotein 1 protein.
          Length = 613

 Score = 31.1 bits (67), Expect = 0.84
 Identities = 15/37 (40%), Positives = 23/37 (62%)
 Frame = +1

Query: 1   FVIRD*PKMGKEKTHINIVVIGHVDSGKSTTTGHLIY 111
           ++IRD P   K+     + V+G+VD+GKST  G L +
Sbjct: 127 WIIRD-PPTEKDFIEARVAVVGNVDAGKSTLLGVLTH 162


>AC024808-3|AAK29925.1|  183|Caenorhabditis elegans Hypothetical
           protein Y53G8AM.6 protein.
          Length = 183

 Score = 31.1 bits (67), Expect = 0.84
 Identities = 17/58 (29%), Positives = 32/58 (55%), Gaps = 2/58 (3%)
 Frame = -1

Query: 601 NGHESDSSWVVANLLECMRILPS*FPQIWAHVWWFSGIHF--VYSYDELFDTEGESEQ 434
           NGH SD +    ++  C+RIL S    ++ H  +++  +F  + S+D+L   E + E+
Sbjct: 40  NGHFSDLASFQVSIEVCVRILLSLVHNVFVHASYYNVFNFENLVSFDKLLPAEKDLEK 97


>U50193-2|AAA91248.1|  974|Caenorhabditis elegans Elongation factor
           protein 1 protein.
          Length = 974

 Score = 30.3 bits (65), Expect = 1.5
 Identities = 15/40 (37%), Positives = 20/40 (50%)
 Frame = +2

Query: 266 TSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 385
           +  Y + IID PGH +F   M      AD  V++V A  G
Sbjct: 198 SKSYLLNIIDTPGHVNFSDEMTASYRLADGVVVMVDAHEG 237


>M86958-1|AAA21824.1|  849|Caenorhabditis elegans eft-1 protein.
          Length = 849

 Score = 30.3 bits (65), Expect = 1.5
 Identities = 15/40 (37%), Positives = 20/40 (50%)
 Frame = +2

Query: 266 TSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 385
           +  Y + IID PGH +F   M      AD  V++V A  G
Sbjct: 73  SKSYLLNIIDTPGHVNFSDEMTASYRLADGVVVMVDAHEG 112


>DQ867020-1|ABI49097.1| 1074|Caenorhabditis elegans eukaryotic
           translation initiationfactor eIF5B protein.
          Length = 1074

 Score = 29.9 bits (64), Expect = 1.9
 Identities = 13/28 (46%), Positives = 16/28 (57%)
 Frame = +2

Query: 287 IIDAPGHRDFIKNMITGTSQADCAVLIV 370
           IID PGH  F      G+S  D A+L+V
Sbjct: 553 IIDTPGHESFSNLRTRGSSLCDFAILVV 580


>Z66513-12|CAI46602.1|  492|Caenorhabditis elegans Hypothetical
           protein F54D5.5b protein.
          Length = 492

 Score = 29.5 bits (63), Expect = 2.6
 Identities = 13/34 (38%), Positives = 19/34 (55%)
 Frame = +1

Query: 127 DKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERE 228
           +KR ++  EKE  +     F Y   LDK+K ER+
Sbjct: 272 EKRKLKDMEKECNDAKNAMFHYMNQLDKVKKERD 305


>Z66513-11|CAA91332.3|  427|Caenorhabditis elegans Hypothetical
           protein F54D5.5a protein.
          Length = 427

 Score = 29.5 bits (63), Expect = 2.6
 Identities = 13/34 (38%), Positives = 19/34 (55%)
 Frame = +1

Query: 127 DKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERE 228
           +KR ++  EKE  +     F Y   LDK+K ER+
Sbjct: 207 EKRKLKDMEKECNDAKNAMFHYMNQLDKVKKERD 240


>Z99709-6|CAB16863.1|  459|Caenorhabditis elegans Hypothetical
          protein C47B2.7a protein.
          Length = 459

 Score = 28.7 bits (61), Expect = 4.5
 Identities = 10/17 (58%), Positives = 15/17 (88%)
 Frame = +1

Query: 46 INIVVIGHVDSGKSTTT 96
          +N+ ++GHVDSGK+T T
Sbjct: 14 LNLGILGHVDSGKTTLT 30


>Z75710-2|CAB00025.2|  381|Caenorhabditis elegans Hypothetical
           protein D1081.4 protein.
          Length = 381

 Score = 27.9 bits (59), Expect = 7.9
 Identities = 17/34 (50%), Positives = 22/34 (64%), Gaps = 2/34 (5%)
 Frame = +2

Query: 281 VTIIDAPGHRDFI--KNMITGTSQADCAVLIVAA 376
           V IID+ G RDFI  KN+  GT  AD  +++ AA
Sbjct: 73  VQIIDSSGSRDFIGMKNLYIGT--ADAFLVVFAA 104


>Z47808-7|CAA87771.2|  934|Caenorhabditis elegans Hypothetical
           protein D2013.5 protein.
          Length = 934

 Score = 27.9 bits (59), Expect = 7.9
 Identities = 13/39 (33%), Positives = 24/39 (61%)
 Frame = +1

Query: 142 EKFEKEAQEMGKGSFKYAWVLDKLKAEREXVSQSILLSE 258
           E+ +K  +EM K   +Y   L++L+ E + + Q +LLS+
Sbjct: 211 ERIQKLQEEMLKTQSQYQRELERLEKENKVLKQRLLLSD 249


>S75262-1|AAC60520.1|  332|Caenorhabditis elegans p34cdc2 kinase
           protein.
          Length = 332

 Score = 27.9 bits (59), Expect = 7.9
 Identities = 14/28 (50%), Positives = 17/28 (60%)
 Frame = -1

Query: 292 NDGNIVLASFELPRAISIVIPXHAQPLV 209
           N+G I LA F L RAI I IP +   +V
Sbjct: 156 NNGAIKLADFGLARAIGIPIPVYTHEVV 183


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 16,526,459
Number of Sequences: 27780
Number of extensions: 350360
Number of successful extensions: 1015
Number of sequences better than 10.0: 34
Number of HSP's better than 10.0 without gapping: 934
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1007
length of database: 12,740,198
effective HSP length: 79
effective length of database: 10,545,578
effective search space used: 1718929214
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -