SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30098.Seq
         (617 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF002196-4|AAB53979.1|  198|Caenorhabditis elegans Ribosomal pro...   134   6e-32
Z49131-3|CAA88976.1| 1211|Caenorhabditis elegans Hypothetical pr...    31   0.50 
U39999-8|AAY44011.1|  146|Caenorhabditis elegans Hypothetical pr...    29   2.7  
Z35604-5|CAA84680.2|  269|Caenorhabditis elegans Hypothetical pr...    29   3.5  
Z49938-3|CAA90188.1|  306|Caenorhabditis elegans Hypothetical pr...    28   4.6  
AF039720-5|AAB96696.1|  408|Caenorhabditis elegans Hypothetical ...    28   4.6  
AF036692-8|AAB88329.1|  162|Caenorhabditis elegans Hypothetical ...    28   4.6  
U58755-16|AAB00705.2|  512|Caenorhabditis elegans Hypothetical p...    28   6.1  
AL132948-22|CAD31825.2| 1408|Caenorhabditis elegans Hypothetical...    27   8.1  

>AF002196-4|AAB53979.1|  198|Caenorhabditis elegans Ribosomal
           protein, large subunitprotein 19 protein.
          Length = 198

 Score =  134 bits (323), Expect = 6e-32
 Identities = 57/85 (67%), Positives = 75/85 (88%)
 Frame = +1

Query: 1   MSSLKLQKRLAASVMRCGKKKVWLDPNEINEIANTNSRQNIRKMIKDGLVIKKPVAVHSR 180
           MS+L+LQKRLA++V++CGK +VWLDPNE++EI+  NSRQ+IR+++ DGL+I+KPV VHSR
Sbjct: 1   MSNLRLQKRLASAVLKCGKHRVWLDPNEVSEISGANSRQSIRRLVNDGLIIRKPVTVHSR 60

Query: 181 ARVRKNTEARRKGRHCGFGKRRGTA 255
            R R+  EARRKGRH G+GKRRGTA
Sbjct: 61  FRAREYEEARRKGRHTGYGKRRGTA 85



 Score =   99 bits (238), Expect = 1e-21
 Identities = 46/85 (54%), Positives = 58/85 (68%)
 Frame = +3

Query: 255 NARMPQKELWXXXXXXXXXXXXXXXTAKKIDRHLYHSLYMKAKGNVFKNKRVLMEYIHRK 434
           NARMP+K LW                AKK+D+HLYH LY++AKGN FKNK+ L+EYI +K
Sbjct: 86  NARMPEKTLWIRRMRVLRNLLRRYRDAKKLDKHLYHELYLRAKGNNFKNKKNLIEYIFKK 145

Query: 435 KAEKARTKMLSDQAEARRNKVKEAR 509
           K E  R K L+DQA+ARR+K KE+R
Sbjct: 146 KTENKRAKQLADQAQARRDKNKESR 170


>Z49131-3|CAA88976.1| 1211|Caenorhabditis elegans Hypothetical protein
            ZC373.4 protein.
          Length = 1211

 Score = 31.5 bits (68), Expect = 0.50
 Identities = 14/45 (31%), Positives = 25/45 (55%)
 Frame = +1

Query: 97   ANTNSRQNIRKMIKDGLVIKKPVAVHSRARVRKNTEARRKGRHCG 231
            ++T+S +N+R ++ D   +K  V  H     R ++E R+K R  G
Sbjct: 1055 SDTSSSKNVRILLTDEQSVKSSVRSHPSVSTRDSSEERKKVRFAG 1099


>U39999-8|AAY44011.1|  146|Caenorhabditis elegans Hypothetical
           protein F41G3.19 protein.
          Length = 146

 Score = 29.1 bits (62), Expect = 2.7
 Identities = 20/69 (28%), Positives = 35/69 (50%), Gaps = 1/69 (1%)
 Frame = -3

Query: 363 SGIDACQSSWQFCTSGAIFLEPFVFVPIVPSVAYAHCSTSSLTKATVTTLSTCL-CVFAD 187
           +G+  C     +CT+ +++L   +     P     +C++SS T +T ++ STC+    A 
Sbjct: 55  NGVSDCPKMASYCTN-SVYLT--LMKTQCPKTC-GYCTSSSSTSSTTSSSSTCVDLTNAS 110

Query: 186 TGAGVDCYR 160
           TG   DC R
Sbjct: 111 TGVS-DCTR 118


>Z35604-5|CAA84680.2|  269|Caenorhabditis elegans Hypothetical
           protein ZK1058.5 protein.
          Length = 269

 Score = 28.7 bits (61), Expect = 3.5
 Identities = 15/39 (38%), Positives = 22/39 (56%), Gaps = 1/39 (2%)
 Frame = +1

Query: 109 SRQNIRKMIK-DGLVIKKPVAVHSRARVRKNTEARRKGR 222
           S +N+RKMIK  G V+ +   ++  A +R   EAR   R
Sbjct: 170 SAENVRKMIKIGGSVVVRDYGINDHAMIRFGREARISDR 208


>Z49938-3|CAA90188.1|  306|Caenorhabditis elegans Hypothetical
           protein F38A3.2 protein.
          Length = 306

 Score = 28.3 bits (60), Expect = 4.6
 Identities = 13/44 (29%), Positives = 22/44 (50%)
 Frame = -2

Query: 298 LCLCTHSSFCGIRALQYLFSYQSHSDDPFYVPLCFCGHGRGSGL 167
           +C+ T ++   I A+  L++Y  H        + FC H R +GL
Sbjct: 25  ICISTVATLTAIVAIPLLYNYMQHVQSTLQTEVDFCKH-RTNGL 67


>AF039720-5|AAB96696.1|  408|Caenorhabditis elegans Hypothetical
           protein F33D11.2 protein.
          Length = 408

 Score = 28.3 bits (60), Expect = 4.6
 Identities = 14/47 (29%), Positives = 25/47 (53%)
 Frame = +3

Query: 432 KKAEKARTKMLSDQAEARRNKVKEARSAARNVLPPRRRNCCRPSLEK 572
           KKAEK +++++  QAEA++N  K   +  +     +     R  L+K
Sbjct: 132 KKAEKVKSELVVPQAEAQKNTPKSVVARKKETKEAKDAKEAREELKK 178


>AF036692-8|AAB88329.1|  162|Caenorhabditis elegans Hypothetical
           protein C44B12.6 protein.
          Length = 162

 Score = 28.3 bits (60), Expect = 4.6
 Identities = 10/24 (41%), Positives = 17/24 (70%)
 Frame = +3

Query: 519 RNVLPPRRRNCCRPSLEKTKPRLP 590
           R++L P+ R+C  PS++K+   LP
Sbjct: 51  RHMLTPKSRDCSEPSIDKSSEVLP 74


>U58755-16|AAB00705.2|  512|Caenorhabditis elegans Hypothetical
           protein C34D4.1 protein.
          Length = 512

 Score = 27.9 bits (59), Expect = 6.1
 Identities = 12/29 (41%), Positives = 18/29 (62%)
 Frame = +3

Query: 429 RKKAEKARTKMLSDQAEARRNKVKEARSA 515
           RKK E+   K    + EA+  K+KEA++A
Sbjct: 365 RKKLEQEEDKKRKKEEEAKNEKIKEAQAA 393


>AL132948-22|CAD31825.2| 1408|Caenorhabditis elegans Hypothetical
            protein Y39B6A.30 protein.
          Length = 1408

 Score = 27.5 bits (58), Expect = 8.1
 Identities = 15/61 (24%), Positives = 28/61 (45%)
 Frame = +3

Query: 339  KIDRHLYHSLYMKAKGNVFKNKRVLMEYIHRKKAEKARTKMLSDQAEARRNKVKEARSAA 518
            K+++    +   K K    +NK  +     R KAE+ + K+  ++ +A   K+K A    
Sbjct: 938  KVEKEKVKAEEEKVKVEKERNKEKVKAEEERLKAEEEKVKIEKEKVKAEEQKIKAAEEER 997

Query: 519  R 521
            R
Sbjct: 998  R 998


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 14,118,368
Number of Sequences: 27780
Number of extensions: 305956
Number of successful extensions: 1073
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 1007
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1072
length of database: 12,740,198
effective HSP length: 78
effective length of database: 10,573,358
effective search space used: 1342816466
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -