SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30097.Seq
         (631 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z81518-1|CAB04214.3|  601|Caenorhabditis elegans Hypothetical pr...    31   0.90 
Z50872-7|CAJ55249.1| 1001|Caenorhabditis elegans Hypothetical pr...    30   1.6  
Z50872-6|CAH10768.1| 1039|Caenorhabditis elegans Hypothetical pr...    30   1.6  
U38378-4|AAA79749.1|  502|Caenorhabditis elegans Hypothetical pr...    28   6.3  
U00052-10|AAK21429.2|  289|Caenorhabditis elegans Rnp (rrm rna b...    28   6.3  
AC024827-2|AAF60805.2|  254|Caenorhabditis elegans Hypothetical ...    28   6.3  
Z49908-3|CAA90094.2|  382|Caenorhabditis elegans Hypothetical pr...    27   8.4  
U23523-1|AAC46560.2|  305|Caenorhabditis elegans Hypothetical pr...    27   8.4  

>Z81518-1|CAB04214.3|  601|Caenorhabditis elegans Hypothetical
           protein F28D9.1 protein.
          Length = 601

 Score = 30.7 bits (66), Expect = 0.90
 Identities = 20/38 (52%), Positives = 22/38 (57%), Gaps = 5/38 (13%)
 Frame = -3

Query: 626 GRAGGRVSPDARRGGRDGCRLRAP--EATPRR---RRD 528
           G  GG  SP ARRGG  G R R+P    +PRR   RRD
Sbjct: 193 GGDGGGGSPAARRGGSAGNRRRSPPRRGSPRRGSPRRD 230



 Score = 27.9 bits (59), Expect = 6.3
 Identities = 13/29 (44%), Positives = 16/29 (55%)
 Frame = +1

Query: 535 RRRGVASGARSLQPSRPPRRASGDTRPPA 621
           RRR  +S +RS  P  PPRR   D+   A
Sbjct: 502 RRRSPSSSSRSRSPPPPPRRPRQDSEQQA 530


>Z50872-7|CAJ55249.1| 1001|Caenorhabditis elegans Hypothetical
           protein C05D12.3c protein.
          Length = 1001

 Score = 29.9 bits (64), Expect = 1.6
 Identities = 19/60 (31%), Positives = 25/60 (41%)
 Frame = -1

Query: 538 DGGMAQNSVLCRCRLIYWVYQSFVPS*WKVQPWGRPLSQVAQCVCGPRQYPAHRPIHSCR 359
           +GG   NS  C+C       +  +    K Q WG P     +CVC P  Y  +  I  CR
Sbjct: 25  NGGTPINSTACQCPAFVAGERCEIV---KCQRWGIPDKD--RCVCAPGWYDKYCGIRGCR 79


>Z50872-6|CAH10768.1| 1039|Caenorhabditis elegans Hypothetical
           protein C05D12.3a protein.
          Length = 1039

 Score = 29.9 bits (64), Expect = 1.6
 Identities = 19/60 (31%), Positives = 25/60 (41%)
 Frame = -1

Query: 538 DGGMAQNSVLCRCRLIYWVYQSFVPS*WKVQPWGRPLSQVAQCVCGPRQYPAHRPIHSCR 359
           +GG   NS  C+C       +  +    K Q WG P     +CVC P  Y  +  I  CR
Sbjct: 25  NGGTPINSTACQCPAFVAGERCEIV---KCQRWGIPDKD--RCVCAPGWYDKYCGIRGCR 79


>U38378-4|AAA79749.1|  502|Caenorhabditis elegans Hypothetical
           protein R11F4.1 protein.
          Length = 502

 Score = 27.9 bits (59), Expect = 6.3
 Identities = 10/29 (34%), Positives = 19/29 (65%)
 Frame = -3

Query: 506 QMQADLLGIPVIRPLMMESTALGAAIVAG 420
           ++QAD++G  ++ P + E +  GAA+  G
Sbjct: 425 EIQADIMGRDIVTPKITEISGWGAAVAGG 453


>U00052-10|AAK21429.2|  289|Caenorhabditis elegans Rnp (rrm rna
           binding domain) containingprotein 5 protein.
          Length = 289

 Score = 27.9 bits (59), Expect = 6.3
 Identities = 18/46 (39%), Positives = 23/46 (50%)
 Frame = +1

Query: 487 SKSACICTELSSAPSLRRRGVASGARSLQPSRPPRRASGDTRPPAR 624
           S S+   +  S + S   R  +S +     SR PRR   DTRPPAR
Sbjct: 17  SSSSSSGSSSSGSSSSGSRSSSSSSSGRSRSRSPRRR--DTRPPAR 60


>AC024827-2|AAF60805.2|  254|Caenorhabditis elegans Hypothetical
           protein Y55F3AR.2 protein.
          Length = 254

 Score = 27.9 bits (59), Expect = 6.3
 Identities = 15/36 (41%), Positives = 17/36 (47%)
 Frame = +1

Query: 520 SAPSLRRRGVASGARSLQPSRPPRRASGDTRPPARP 627
           S    R  G  +G+ S   S  P RASG   PPA P
Sbjct: 113 SGTGQRLSGSTTGSSSSTSSSAPPRASGAAPPPAGP 148


>Z49908-3|CAA90094.2|  382|Caenorhabditis elegans Hypothetical
           protein C07E3.3 protein.
          Length = 382

 Score = 27.5 bits (58), Expect = 8.4
 Identities = 20/68 (29%), Positives = 31/68 (45%), Gaps = 2/68 (2%)
 Frame = +1

Query: 403 HTRIARPATMAAPRAVLSIMRGRMTGIPSKSACICTE--LSSAPSLRRRGVASGARSLQP 576
           H   + PAT  A + +  +  GR   IP+ S     +  +  +P L+RR V S      P
Sbjct: 108 HASPSDPATYFALKPMTEVNEGRQFSIPTSSTRRYDQVPIDPSPELQRREVPS---KQSP 164

Query: 577 SRPPRRAS 600
              P+R+S
Sbjct: 165 PNYPKRSS 172


>U23523-1|AAC46560.2|  305|Caenorhabditis elegans Hypothetical
           protein F53A9.5 protein.
          Length = 305

 Score = 27.5 bits (58), Expect = 8.4
 Identities = 8/16 (50%), Positives = 11/16 (68%)
 Frame = -1

Query: 457 WKVQPWGRPLSQVAQC 410
           W+  PW  P+S +AQC
Sbjct: 121 WRSTPWTLPISNIAQC 136


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 14,545,392
Number of Sequences: 27780
Number of extensions: 334199
Number of successful extensions: 886
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 832
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 886
length of database: 12,740,198
effective HSP length: 78
effective length of database: 10,573,358
effective search space used: 1385109898
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -