SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30080.Seq
         (853 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z68760-13|CAD30434.1|  423|Caenorhabditis elegans Hypothetical p...    35   0.084
AL032641-7|CAD30455.1|  423|Caenorhabditis elegans Hypothetical ...    35   0.084
Z68760-12|CAD27623.1|  436|Caenorhabditis elegans Hypothetical p...    32   0.45 
Z68760-11|CAA92997.2|  438|Caenorhabditis elegans Hypothetical p...    32   0.45 
X68070-1|CAA48207.1|  438|Caenorhabditis elegans Lin-3 protein.        32   0.45 
AL032641-6|CAD27613.1|  436|Caenorhabditis elegans Hypothetical ...    32   0.45 
AL032641-5|CAA21649.2|  438|Caenorhabditis elegans Hypothetical ...    32   0.45 
Z68760-15|CAL44969.1|  462|Caenorhabditis elegans Hypothetical p...    29   4.2  
AL032641-9|CAL44964.1|  462|Caenorhabditis elegans Hypothetical ...    29   4.2  
Z78413-5|CAB01661.2|  243|Caenorhabditis elegans Hypothetical pr...    29   5.5  

>Z68760-13|CAD30434.1|  423|Caenorhabditis elegans Hypothetical
           protein F36H1.4c protein.
          Length = 423

 Score = 34.7 bits (76), Expect = 0.084
 Identities = 16/40 (40%), Positives = 21/40 (52%)
 Frame = -1

Query: 322 CPSGWERLRL*RAWXQACLCPLSGLFGPSX*APSPAXALL 203
           CP GWE  R  R + QA   P++G +  S  +  PA A L
Sbjct: 184 CPQGWEGTRCDRHYVQAFYAPINGRYNQSSTSAIPAFAFL 223


>AL032641-7|CAD30455.1|  423|Caenorhabditis elegans Hypothetical
           protein F36H1.4c protein.
          Length = 423

 Score = 34.7 bits (76), Expect = 0.084
 Identities = 16/40 (40%), Positives = 21/40 (52%)
 Frame = -1

Query: 322 CPSGWERLRL*RAWXQACLCPLSGLFGPSX*APSPAXALL 203
           CP GWE  R  R + QA   P++G +  S  +  PA A L
Sbjct: 184 CPQGWEGTRCDRHYVQAFYAPINGRYNQSSTSAIPAFAFL 223


>Z68760-12|CAD27623.1|  436|Caenorhabditis elegans Hypothetical
           protein F36H1.4b protein.
          Length = 436

 Score = 32.3 bits (70), Expect = 0.45
 Identities = 17/50 (34%), Positives = 21/50 (42%)
 Frame = -1

Query: 322 CPSGWERLRL*RAWXQACLCPLSGLFGPSX*APSPAXALLTHQEXRSHRP 173
           CP GWE  R  R + QA   P++G +       S    LL  Q   S  P
Sbjct: 182 CPQGWEGTRCDRHYVQAFYAPINGRYNVRLSTMSSTAQLLVQQSSTSAIP 231


>Z68760-11|CAA92997.2|  438|Caenorhabditis elegans Hypothetical
           protein F36H1.4a protein.
          Length = 438

 Score = 32.3 bits (70), Expect = 0.45
 Identities = 17/50 (34%), Positives = 21/50 (42%)
 Frame = -1

Query: 322 CPSGWERLRL*RAWXQACLCPLSGLFGPSX*APSPAXALLTHQEXRSHRP 173
           CP GWE  R  R + QA   P++G +       S    LL  Q   S  P
Sbjct: 184 CPQGWEGTRCDRHYVQAFYAPINGRYNVRLSTMSSTAQLLVQQSSTSAIP 233


>X68070-1|CAA48207.1|  438|Caenorhabditis elegans Lin-3 protein.
          Length = 438

 Score = 32.3 bits (70), Expect = 0.45
 Identities = 17/50 (34%), Positives = 21/50 (42%)
 Frame = -1

Query: 322 CPSGWERLRL*RAWXQACLCPLSGLFGPSX*APSPAXALLTHQEXRSHRP 173
           CP GWE  R  R + QA   P++G +       S    LL  Q   S  P
Sbjct: 184 CPQGWEGTRCDRHYVQAFYAPINGRYNVRLSTMSSTAQLLVQQSSTSAIP 233


>AL032641-6|CAD27613.1|  436|Caenorhabditis elegans Hypothetical
           protein F36H1.4b protein.
          Length = 436

 Score = 32.3 bits (70), Expect = 0.45
 Identities = 17/50 (34%), Positives = 21/50 (42%)
 Frame = -1

Query: 322 CPSGWERLRL*RAWXQACLCPLSGLFGPSX*APSPAXALLTHQEXRSHRP 173
           CP GWE  R  R + QA   P++G +       S    LL  Q   S  P
Sbjct: 182 CPQGWEGTRCDRHYVQAFYAPINGRYNVRLSTMSSTAQLLVQQSSTSAIP 231


>AL032641-5|CAA21649.2|  438|Caenorhabditis elegans Hypothetical
           protein F36H1.4a protein.
          Length = 438

 Score = 32.3 bits (70), Expect = 0.45
 Identities = 17/50 (34%), Positives = 21/50 (42%)
 Frame = -1

Query: 322 CPSGWERLRL*RAWXQACLCPLSGLFGPSX*APSPAXALLTHQEXRSHRP 173
           CP GWE  R  R + QA   P++G +       S    LL  Q   S  P
Sbjct: 184 CPQGWEGTRCDRHYVQAFYAPINGRYNVRLSTMSSTAQLLVQQSSTSAIP 233


>Z68760-15|CAL44969.1|  462|Caenorhabditis elegans Hypothetical
           protein F36H1.4d protein.
          Length = 462

 Score = 29.1 bits (62), Expect = 4.2
 Identities = 11/26 (42%), Positives = 15/26 (57%)
 Frame = -1

Query: 322 CPSGWERLRL*RAWXQACLCPLSGLF 245
           CP GWE  R  R + QA   P++G +
Sbjct: 182 CPQGWEGTRCDRHYVQAFYAPINGRY 207


>AL032641-9|CAL44964.1|  462|Caenorhabditis elegans Hypothetical
           protein F36H1.4d protein.
          Length = 462

 Score = 29.1 bits (62), Expect = 4.2
 Identities = 11/26 (42%), Positives = 15/26 (57%)
 Frame = -1

Query: 322 CPSGWERLRL*RAWXQACLCPLSGLF 245
           CP GWE  R  R + QA   P++G +
Sbjct: 182 CPQGWEGTRCDRHYVQAFYAPINGRY 207


>Z78413-5|CAB01661.2|  243|Caenorhabditis elegans Hypothetical
           protein T01C3.5 protein.
          Length = 243

 Score = 28.7 bits (61), Expect = 5.5
 Identities = 16/56 (28%), Positives = 27/56 (48%), Gaps = 2/56 (3%)
 Frame = +3

Query: 561 DGAERSRFHQDHRVXLVRHRXGPAFLLXNRGK--RXFDPKIPASDKNRXEIQFDQE 722
           DG +   F    +V  + +  GPA +  N GK  R   PK+ A +    ++QF+ +
Sbjct: 79  DGTDLETFDLLPQVEQILNPDGPAIIFKNNGKLQRILMPKLLALNGKDEDVQFEND 134


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 13,742,181
Number of Sequences: 27780
Number of extensions: 216384
Number of successful extensions: 319
Number of sequences better than 10.0: 10
Number of HSP's better than 10.0 without gapping: 303
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 319
length of database: 12,740,198
effective HSP length: 81
effective length of database: 10,490,018
effective search space used: 2118983636
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -